today at IDS Cologne 16 March 2023

News / Sicherheit, Flexibilität und Einfachheit – NiTi-Feilen für jeden Wurzelkanal - Safety, flexibility and simplicity—NiTi files for every root canal / News / Industry / Was ist sonst noch los in Köln? - What’s on in Cologne?

Open PDF View E-paper Edit Epaper Edit Epaper ads save

Table of contents

) [58] => Array ( [image_url] => Array ( [2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/87045-39e2613b/2000/page-57.jpg [1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/87045-39e2613b/1000/page-57.jpg [200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/87045-39e2613b/200/page-57.jpg ) [key] => Array ( [2000] => 87045-39e2613b/2000/page-57.jpg [1000] => 87045-39e2613b/1000/page-57.jpg [200] => 87045-39e2613b/200/page-57.jpg ) [ads] => Array ( [0] => Array ( [post_data] => WP_Post Object ( [ID] => 87058 [post_author] => 0 [post_date] => 2024-12-18 10:36:53 [post_date_gmt] => 2024-12-18 10:36:53 [post_content] => [post_title] => epaper-87045-page-58-ad-87058 [post_excerpt] => [post_status] => publish [comment_status] => closed [ping_status] => closed [post_password] => [post_name] => epaper-87045-page-58-ad-87058 [to_ping] => [pinged] => [post_modified] => 2024-12-18 10:36:53 [post_modified_gmt] => 2024-12-18 10:36:53 [post_content_filtered] => [post_parent] => 0 [guid] => https://e.dental-tribune.com/ad/epaper-87045-page-58-ad/ [menu_order] => 0 [post_type] => ad [post_mime_type] => [comment_count] => 0 [filter] => raw ) [id] => 87058 [id_hash] => 2196d504b0991765dd856efd9bfd08528899e6d5f8f275b3f44d8cf36ff09486 [post_type] => ad [post_date] => 2024-12-18 10:36:53 [fields] => Array ( [url] => https://www.dtstudyclub.com/ [link] => URL ) [permalink] => https://e.dental-tribune.com/ad/epaper-87045-page-58-ad-87058/ [post_title] => epaper-87045-page-58-ad-87058 [post_status] => publish [position] => 5.5727554179567,55.844155844156,51.702786377709,37.012987012987 [belongs_to_epaper] => 87045 [page] => 58 [cached] => false ) ) [html_content] =>

Open Link

Open Link

) ) [pdf_filetime] => 1734518213 [s3_key] => 87045-39e2613b [pdf] => today at IDS Cologne 16 March 2023.pdf [pdf_location_url] => https://e.dental-tribune.com/tmp/dental-tribune-com/87045/today at IDS Cologne 16 March 2023.pdf [pdf_location_local] => /var/www/vhosts/e.dental-tribune.com/httpdocs/tmp/dental-tribune-com/87045/today at IDS Cologne 16 March 2023.pdf [should_regen_pages] => 1 [pdf_url] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/87045-39e2613b/epaper.pdf [pages_text] => Array ( [1] =>

Thursday
16 March

16.3.
updated daily

40th International Dental Show • Cologne • 14–18 March 2023

Interview

3D printing

Product focus

JIZAI – neue Endodontie-Feilen
von MANI

Neue Gesellschaft für 3D-Druck
vorgestellt

Digitale Workflows von Neoss

JIZAI—new endodontic files
from MANI

New society for 3D printing
introduced

»8

Digital workflows from Neoss

» 12

Neoss bringt „Intelligent Simplicity“ auf der
IDS 2023 zum Leben
Neoss brings “Intelligent Simplicity” to
life at IDS 2023

us !
t
i
s
i
v
Come

» 18

People of today

Hall 11.3, Stand C010
AD

When
you need
Chlorhexidine.

Neuer digitaler Workflow und gesteuerte Knochenregeneration auf höchstem Niveau.
New digital workflow and guided bone regeneration excellence.
n Am Mittwochmorgen hat der schwedische Implantathersteller Neoss auf
der IDS-Pressekonferenz in Köln unter dem Motto des Unternehmens
“Intelligent Simplicity” einen neuen
digitalen Workflow und einen neuen
Typ einer PTFE-Membran vorgestellt.
»2

Stanley M. Bergman, chairman of the
board and CEO of Henry Schein

Von links: Dr. Marcus Dagnelid, Spezialist für Zahnprothetik, Dr. Robert Gottlander, CEO und
Präsident von Neoss, und Sebastian Bauer, Leiter Produktmanagement Neoss.

From left: Dr Marcus Dagnelid, specialist in prosthodontics; Dr Robert Gottlander CEO and president
of Neoss and Sebastian Bauer, director of product management at Neoss.


Aufruf an alle
modernen
Zahnärzte
Calling modern dentists

Digitaler Artikulator
Digital articulator

n DirectEndodontics provides dynamic dental professionals based in
Europe with locally made reciprocating and rotary instruments. The company’s products directly replace the instruments that dentists currently use
without requiring them to change techniques, all at a fraction of the price.
Endodontist Dr Charles J. Goodis
founded US-based EdgeEndo ten years
ago, and the company is now
»2

THE GLOBAL DENTAL CE COMMUNITY

www.dtstudyclub.com
@DTStudyClub

sagemax.com

Florian Mack von SAM Präzisionstechnik im Interview.
An interview with Florian Mack from SAM Präzisionstechnik.

DirectEndodontics kommt
direkt zum Kunden.
DirectEndodontics cuts out the
middleman.
n DirectEndodontics bietet lokal hergestellte reziproke und rotierende Instrumente für Zahnärzte in ganz Europa.
Die zuvor genutzten Instrumente können direkt durch die erheblich günstigeren Produkte des Unternehmens ersetzt werden. Die Technik bleibt die
gleiche.
»2

„Wir bleiben unserem Engagement
für innovative öffentlich-private Partnerschaften und den Ausbau unserer
Arbeit mit wichtigen Interessengruppen treu, um die Welt gesünder zu
machen.“
“We remain steadfast in our commitment to engaging in innovative
public–private partnerships and expanding our work with key stakeholders to make the world healthier.”

Come visit us
IDS C070 - HALLE 5.2

Halle 4.1
Stand A091

F lorian Mack, geschäftsführender Gesellschafter bei SAM Präzisionstechnik.

F lorian Mack, managing partner of SAM Präzisionstechnik.


n Die Ausrichtung von digitalen Modellen in der CAD-Software und das
spätere Umsetzen in gedruckte Modelle entsprechend des Bissregis
trats ist im stressigen Praxis- und
Laboralltag nicht immer unproblematisch. SAM Präzisionstechnik
bietet mit speziell entwickelten
Software-Lösungen sowie einem
Transferbogensystem die einfache
und kostengünstige Möglichkeit,
den gesamten Workflow – von der
Planung bis zum Druck –
»4

n In the stressful daily routine of the
practice and laboratory, the alignment of
digital models in CAD software and converting them afterwards into printed
models according to the bite registration
is not always as easy as it looks. By
means of specially developed software
solutions and a transfer adapter system,
SAM Präzisionstechnik offers a simple
and cost-effective option for configuring
the entire workflow—from planning to
printing—completely digitally. In this interview, Florian Mack,
»4

VISIT
US!
LIVE VORTRÄGE

Wir bringen die SagemaxCommunity nach Köln!
Für mehr Informationen bitte QR-Code einscannen

n On Wednesday morning, Swedish implant manufacturer Neoss presented a
new digital workflow and a new type of
PTFE membrane at its IDS press conference in Cologne under the company’s
motto “Intelligent Simplicity”. In addition,
it was announced
»2

[2] =>

news

« 1 – DirectEndodontics
EdgeEndo mit Sitz in den Vereinigten Staaten wurde vor zehn Jahren von
dem Endodontisten Dr. Charles J. Goodis
gegründet. Das Unternehmen gehört
mittlerweile zu den größten Anbietern

Endodontist Dr Charles J. Goodis is the founder
of DirectEndodontics.

von Endodontie-Geräten in den USA. Es
beliefert 5.000 Endodontologen und
35.000 weitere Zahnärzte. Damit auch
europäische Kliniker die Vorteile
dieser Instrumente nutzen können, hat
Dr. Goodis DirectEndodontics für den
Direktvertrieb in Europa gegründet.
Die Instrumente sind so konzipiert,
dass sie die reziproken und goldenen Ke-

« 1 – Neoss
Außerdem wurde bekanntgegeben,
dass Prof. Neil Meredith, der Neoss im
Jahr 2000 mitbegründet hatte, als Berater in das Unternehmen zurückkehrt.
„Neoss bietet alles an, was Zahnärztinnen und Zahnärzte brauchen,

* Adapter gehören nicht zum Lieferumfang!

gel- und Rotationsinstrumente führender Hersteller direkt ersetzen können.
Das Design verbessert die Schneidwirkung und gewährleistet mehr Sicherheit
sowie die für eine perfekte Wurzelkanalbehandlung erforderliche Flexibilität.
DirectEndodontics hilft Klinikern bei
der Erreichung ihrer klinischen, geschäftlichen und persönlichen Ziele –
dank der vielen Vorteile, die die besten
endodontischen Instrumente bieten.
Dr. Goodis erklärt dazu: „Mein Ziel?
Hervorragende endodontische Instrumente aus europäischer Produktion im
Direktvertrieb zu einem Bruchteil des
Preises der Konkurrenz zu bieten. Sie
sparen sich das Hin und Her mit den
Vertriebsﬁrmen, Vertretern und Callcentern, und die hohen Versandkosten verringern sich beträchtlich. Ich möchte
DirectEndodontics als modernes, frisches, digitales Unternehmen aufstellen,
das mit den Zahnärzten der jüngeren
Generationen zusammenarbeitet.“
„Wir sind keins dieser Endodontieunternehmen der Vätergeneration, das
immer noch in der Vergangenheit lebt,
hohe Preise verlangt, mit Vertriebsfirmen arbeitet und beträchtliche
Transportkosten verursacht“, betont
Dr. Goodis. „Kommen Sie zu uns und nutzen Sie unsere erstklassigen Instrumente!“
Besuchen Sie das Unternehmen auf
der IDS (Halle 4.1., Stand A015) oder im
Netz (www.directendo.com) und lernen
Sie alle Vorteile von DirectEndodontics
kennen.

um ihre Patienten mit Implantaten
zu versorgen – alles unter dem Aspekt unseres eﬃzienten digitalen
Workﬂows und nach dem Prinzip ‚Intelligent Simplicity‘. Dieser digitale
Workﬂow spart Zeit und Geld und
sorgt für zuverlässige Ergebnisse.
Und das ist es, was für die Patienten

Stand von DirectEndodondontics auf der diesjährigen IDS. The DirectEndodontics booth at this year’s IDS.

« 1 – DirectEndodontics
one of the largest endodontic suppliers
in the US, where it serves 5,000 endodontists and 35,000 general dentists.
He was inspired to bring the same advantages to clinicians in Europe and so
he founded DirectEndodontics to sell
the company’s instruments directly to
clinicians in Europe.
The instruments are designed to be
a direct replacement of leading reciprocating and gold taper and rotary instruments, oﬀering advanced designs that
improve cutting eﬃciency and increase

safety in order to provide the ideal ﬂexibility required for perfect root canal
therapy. DirectEndodontics helps clinicians to achieve their clinical, business
and personal goals while enjoying the
beneﬁts of the best endodontic instruments.
Dr Goodis explained: “My goal is to
bring you great European endodontic
instruments, selling directly and at a
fraction of the price. This allows you to
eliminate the hassles of dealing with
distributors, sales representatives and
call centres, and to save money on expensive shipping costs. I want Direc-

tEndodontics to be a modern, fresh,
digital, millennial and Gen X company
working with you, the modern dentist.”
“We are not your dad’s old endodontic company which continues to live
in the past, asking high prices, going
through distributors and charging for
shipping,” Dr Goodis emphasised. “Join
us now and start beneﬁting from the
amazing instruments!” he said.
Visit the company’s booth at IDS
(Hall 4.1, Booth A015) or its website
(www.directendo.com) in order to discover the advantages of DirectEndodontics for yourself.

zählt“, erklärte Dr. Robert Gottlander, CEO und Präsident von Neoss.
Der neue digitale Workﬂow besteht aus sechs einfachen Schritten,
darunter der Einsatz des Scan- und
Heilungs-Abutments ScanPeg und
des Intraoralscanners NeoScan 1000,
der erst im letzten Jahr auf den

Sicher.
Sauber.
ALPRO.
Semimaschinelle Aufbereitung
zahnärztlicher Übertragungsinstrumente

MYKOBAKTER
IZID
FUNGIZ
ID
VOLL
VIRUZID

Besuchen Sie uns
in Halle 11.2
Stand N 008/O 009

« 1 – DirectEndodontics

Eigenschaften:
1. WL-clean:
reinigend
komplexierend
emulgierend
QLFKW SURWHLQÀ[LHUHQG
2. WL-cid:
bakterizid
fungizid
mykobakterizid
viruzid
3. WL-dry:
trocknend
reinigungsunterstützend

Dr. Robert Gottlander, CEO und Präsident von Neoss, stellt das Firmenmotto vor.
Dr Robert Gottlander, CEO and president of Neoss, presents the company’s motto.

Markt gekommen ist. Auf diese
Weise ist das beste Ergebnis für die
Patienten gewährleistet – funktionell und ästhetisch.
Zusätzlich dazu hat Neoss seine
Produktfamilie um NeoGen Cape erweitert. Es handelt sich um einen
neuen Typ von PTFE-Membran.
Diese Lösung ist einfach zu ﬁxieren,
erfordert weniger Arbeitsschritte,
die Membran ist stabiler und sichert
das Implantat besser. Schließlich
sorgt sie – klinisch erwiesen – für
einen planmäßigen vertikalen Knochenaufbau.
Prof. Neil Meredith nahm als
Überraschungsgast an der Pressekonferenz teil. Der Miterﬁnder der
Resonanzfrequenzanalyse für Zahnimplantate hatte Neoss im Jahr 2011
verlassen, um sich der Wissenschaft
zu widmen. Jetzt ist er als Berater zurück. „Wir sind sehr froh, dass wir
ihn wiederhaben“, betonte Dr. Gottlander.
„Für eine korrekte Behandlung
der Patienten ist ein reibungsloser

und einfacher Arbeitsablauf am
wichtigsten. Ich glaube, dass Neoss
die beste Lösung dafür ist, und ich
freue mich sehr über die Zusammenarbeit“, so Prof. Meredith.
„Wir laden alle Messebesucher
ein, unseren Intraoralscanner NeoScan 1000 und unser ScanPeg-System auszuprobieren“, sagte Dr. Gottlander. Besucherinnen und Besucher
der IDS ﬁnden den Neoss-Stand
(G010/H029) in Halle 11.3.
« 1 – Neoss
that Prof. Neil Meredith, who cofounded Neoss back in 2000 would rejoin the company as an adviser.
“At Neoss, we provide everything
dental professionals need to treat their
patients with implants—all under the
umbrella of our eﬃcient digital workﬂow and intelligent simplicity ethos. We
created a digital workﬂow which saves
time and money, but provides a predictable outcome for patients, which is
key,” said
»4

[3] =>

More at once

Minimize hands-on time with the intuitive
place-and-scan design. Provide a complete
range of quality services to your clinics
with ease. Stay on top of your caseload
with fast automated scan-to-design workﬂows.
More eﬃciency. More versatility. More speed.
www.3shape.com/f8

Experience the world of 3Shape
at booth Hall 4, Floor 2 Booth # J098/K099

Gain the power
of dual model
scanning

[4] =>

news

« 1 – SAM Präzisionstechnik
vollständig digital zu gestalten. Im
Interview stellt Florian Mack, geschäftsführender Gesellschafter von
SAM Präzisionstechnik, die Systeme
AxioPrisa und AxioSnapMount vor.
Im Rahmen der IDS präsentieren Sie
Ihr digitales Transferbogensystem
AxioPrisa. Was macht dieses System
besonders?
AxioPrisa ist im wahrsten Sinne
des Wortes der „missing link“ und
wir konnten zwei Fliegen mit einer
Klappe schlagen. Es muss nur ein
zweiter Oberkieferscan mit dem
speziellen AxioPrisa-Bissgabelträger
erstellt und anschließend in der
dazugehörigen AxioPrisa-Software
mit Artikulator und OberkieferUnterkiefer-Scan digital gematcht
werden. Dieser AxioPrisa-Bissgabelträger ist nicht nur für den
SAM-Transferbogen erhältlich –
auch für Anwender des Artex Rotoﬁx, Denar Slidematic, Panadent
Panamount, Gamma Reference etc.
stehen individuelle Bissgabelträger
zur Verfügung.

Im zweiten Halbjahr bekommt
die Software ein optionales Feature,
initiiert durch Dr. Domingo Martin
und Dr. Alberto Canabez, zwei
Kieferorthopädie-Experten aus Spanien. Jetzt kann auch mit Registratträger im Patientenmund die Situation in zentrischer Relation gescannt
und in der AxioPrisa-Software auf
den ersten Kontaktpunkt rotiert werden.
Was zeichnet die Software in puncto
Planung und Modellherstellung aus?
Die anatomisch richtige Zuordnung und Gleichschaltung von Patient und Artikulator ist essenziell für
die Herstellung von jeglichem Zahnersatz, bei dem die Zähne kontaktieren und in Funktion stehen. Wenn
dieser Startpunkt fehlt, sind die weiteren Informationen nicht mehr entscheidend. Was diese Software besonders macht? Sie ist intuitiv
bedienbar, daher die Arbeitsschritte
delegierbar und kostengünstig in
der Anschaﬀung. Zudem ist die Software sowohl für Apple als auch
Windows verfügbar. Uns macht besonders stolz, dass wir 2021 den

A xioprisa ist ein digitalisierbarer Bissgabelträger für den Intraoralscan, der 2021 mit dem Red
Dot Award ausgezeichnet wurde.
A xioprisa is a digitisable bite fork carrier for intra-oral scans, which received the Red Dot Award in
2021.

In the second half of the year, the
software will get an optional feature, initiated by two orthodontic experts from
Spain, Drs Domingo Martin and Alberto
Canabez. Clinicians will be able to scan
the situation in centric relation and rotate it to the ﬁrst contact point in the
AxioPrisa software—even with bite registration material in the patient’s mouth.

M it der AxioSnapMount-Software wurde eine Brücke vom Intraoralscan zum 3D-Druckmodell
geschaﬀen, ohne Gips oder inakkurate Miniartikulatoren.

With the AxioSnapMount, a software was created to bridge gap between the intra-oral scan and the
3D-printed model, without the need for plaster or inaccurate mini articulators.

Red Dot Award damit gewonnen
haben und kurz vor der Patentzulassung stehen.

ber zu erfahren. Servus, Danke und
weiterhin eine friedliche, spannende
und erfolgreiche Messe.

Mit der Software AxioSnapMount, einem Montagesystem für analoge
und digitale Modelle, erweitert SAM
Präzisionstechnik sein Portfolio.
Was verbirgt sich dahinter?
Das AxioSnapMount-System haben wir erstmalig als Prototyp 2019
bzw. Vorserie auf der IDS 2021 vorgestellt. Der größte Abstand zwischen
Artikulator und Modell wird durch
eine Kombination aus Alublock und
Magnetmontageplatte mit Splitcast
überbrückt und das Modell mit einer
neuen Basis modiﬁziert. Verschiedene Höhen der Alublöcke und der
Montageplatte stehen zur Verfügung.
Für weitere Artikulatoren, wie Artex,
Denar, Panadent etc., gibt es ebenfalls
hochwertige Aluminiumblöcke. Das
System ist also oﬀen für die gängigsten Artikulatorensysteme – und das
mit nur einer Software.
Ich lade alle Interessierten herzlich ein, uns in Halle 10.2 am Stand
O041 zu besuchen, um mehr darü-

« 1 – SAM Präzisionstechnik

P roduktvorführung des NeoScan 1000.
Product demonstration of the NeoScan 1000.

managing partner of SAM Präzisionstechnik, explains the AxioPrisa and
AxioSnapMount systems.
At IDS, you are presenting your AxioPrisa digital transfer adapter system.
What makes this system special?
AxioPrisa is literally the missing
link, allowing the clinician to achieve
two tasks together. All the clinician
has to do is create a second upper
jaw scan with the special AxioPrisa
transfer adapter and then digitally
match it in the associated AxioPrisa
software with the articulator and upper or lower jaw scan. This AxioPrisa transfer adapter isn’t available
just for the SAM facebow; customised transfer adapters are also available for users of the Artex Rotoﬁx,
Denar Slidematic, Panadent PanaMount and GAMMA Reference,
among others.

Dr Robert Gottlander, CEO and president of Neoss.
Delivering the best functional and
aesthetic outcome for patients, the
new digital workﬂow consists of six
easy steps and involves the use of the

Could you tell us more about your
AxioSnapMount software, an assembly system for analogue and digital
models, also a new addition to SAM
Präzisionstechnik’s portfolio?
We presented the AxioSnapMount
system for the ﬁrst time as a prototype in
2019 and as a pilot product at the 2021
IDS. The largest distance between articulator and model is bridged by a combination of an aluminium block and magnetic
mounting plate with split-cast mounting,
and the model is modiﬁed with a new
base. Diﬀerent heights for the aluminium blocks and mounting plate are available. High-quality aluminium blocks are
also available for other articulators, such
as Artex, Denar and Panadent, so the
system is accessible for the most common articulator systems—using only one
software program.
I cordially invite anyone interested
to visit us at Booth O041 in Hall 10.2 to
ﬁnd out more.

P rof. Neil Meredith war live aus Australien zugeschaltet.
Prof. Neil Meredith joined the event online from Australia.

« 1 – Neoss

What distinguishes the software in terms
of planning and model fabrication?
Anatomically correct allocation and
synchronisation of the patient and articulator are essential for the manufacture
of any dental prosthesis where the teeth
are in contact and in function. If this
starting point is missing, the additional
information is no longer decisive. What
makes this software special? It can be
operated intuitively; thus, the work steps
can be delegated. It is also inexpensive to
purchase. In addition, the software is
available for both macOS and Windows.
We’re particularly proud of the fact that
we won the Red Dot Award for it in 2021,
and we are about to receive patent approval.

ScanPeg scanning and healing abutment and the NeoScan 1000 intra-oral
scanner, which was launched last year.
In addition, Neoss expanded its
product family with NeoGen Cape, a
new type of PTFE membrane. This
novel solution is easy to ﬁxate, requires fewer steps, has a higher mem-

brane stability, thereby securing the
implant, and oﬀers predictable vertical
bone growth, backed by clinical evidence.
Prof. Meredith joined the press
event as a surprise guest. The co-inventor of resonance frequency analysis
for dental implants left Neoss in 2011

to devote himself to science and has
now returned as an adviser. “We are
very happy to have him back,” emphasised Dr Gottlander.
“The most important thing to properly treat your patients is a smooth
and simple workﬂow, and I believe
Neoss is the very best way to do this,

40th International Dental Show 2023 • 16. März 16 March

and I am very happy to be partnering
with them,” said Prof. Meredith.
“We invite attendees to come visit
us to try out our intra-oral scanner
NeoScan 1000 and our ScanPeg,” said
Dr Gottlander. IDS visitors can ﬁnd
the Neoss booth (#G010/H029) in Hall
11.3.

[5] =>

¡êƎơśĔƎƕȿ
ĸśȿĔǇćĔŐŐĔśćĔȡȿ
½śĸơĔĎȿ
ĆǈȿƕřĸŐĔƕȡ

ŐĔêƎŧƎƎĔćơɶȜȿơĴĔȿ«ơƎêƨřêśśȿ
EƎŧƨƋȽƕȿǗêĭƕĴĸƋȿŧƎơĴŧĎŧśơĸćȿ
ĆƎêśĎȜȿĸƕȿĔǇćĸơĔĎȿơŧȿêśśŧƨśćĔȿ
śĔǂȿƋƎŧĎƨćơƕȿêśĎȿĬĔêơƨƎĔƕȿ
ŐêƨśćĴĸśĭȿêơȿQ%«ȜȿĴĔŐƋĸśĭȿĎŧćơŧƎƕȿ
ơƎĔêơȿřŧƎĔȿćŧřƋŐĔǇȿćêƕĔƕȿǂĸơĴȿ
śĔǂȿćŐĸśĸćêŐȿĬĔêơƨƎĔƕȜȿêśȿĸřƋƎŧǁĔĎȿ
ĎĸĭĸơêŐȿǂŧƎōǗŧǂȜȿêĎĎĔĎȿƕƨƋƋŧƎơȜȿ
êśĎȿơƎĔêơřĔśơȿƋŐêśśĸśĭȿƕĔƎǁĸćĔƕȡˀ
ÕĸƕĸơȿơĴĔřȿêơȿơĴĔȿ«ơƎêƨřêśśȿĆŧŧơĴȿ
ȯMêŐŐȿǟȡǝȿɺȿ«ơêśĎȿEȳǛǣǛȿbȳǛǣǤȰȿ

ćŐĔêƎćŧƎƎĔćơȡćŧř

Acc.1247_en_B_01

[6] =>

news

Gesichter der IDS Faces of IDS
Takara Belmont lud am Dienstagabend Freunde und Partner an seinen IDS-Stand
(G010/H019) in Halle 11.1 ein, um dem dentalen Fachpublikum die neuen Modelle der Behandlungseinheit EURUS vorzustellen. Bei erstklassigem Fingerfood
deutscher und asiatischer Köstlichkeiten sowie erfrischenden Getränken konnten
die zahlreichen Gäste den ersten Messetag mit guten Gesprächen in entspannter
Atmosphäre ausklingen lassen.
Takara Belmont invited friends and partners to its IDS booth (#G010/H019) in
Hall 11.1 on Tuesday evening to present the new models of its treatment unit EURUS
to the dental trade audience. With first-class finger food of German and Asian
delicacies and refreshing drinks, the numerous guests were able to round off the
first day of the trade fair with engaging conversations in a relaxed atmosphere.

1 Besucherinnen und Besucher des Curaden-Stands in Halle 5.2 erfahren mehr über Produkte der Marke CURAPROX. Visitors to the Curaden booth
in Hall 5.2 learn more about products of the CURAPROX brand. (© Koelnmesse) 2 Das japanische Unternehmen GC zeigt IDS-Gästen eine Show, die
die Kunst des traditionellen japanischen Duells darstellt. (© Robert Strehler) Japanese company GC treats IDS guests to a show depicting the art of
ancient Japanese dueling. (© Robert Strehler). 3 Die Visualisierung von Unterkieferbewegungen in 4D ist dank des französischen Unternehmens
Modjaw möglich, das sich an Stand C010, Halle 1.2 beﬁndet. Visualising mandibular movement in 4D is possible thanks to French-based Modjaw, situated at Booth C010, Hall 1.2. (© Koelnmesse) 4 Gäste aus aller Welt versammeln sich zahlreich, um die neueste Technologie zu entdecken, die auf der
IDS 2023 verfügbar ist. Guests from around the world gather en masse to discover the latest technology available at IDS 2023. (© Koelnmesse) 5 Nach
einer kleineren Ausgabe der IDS während der Pandemie ist die Koelnmesse stolz darauf, pünktlich zum 100. Jubiläum wieder ein vollumfängliches
Event zu veranstalten. After a smaller edition of IDS during the pandemic, Koelnmesse is proud to once again host a full turnout, just in time for the
100th anniversary. (© Koelnmesse) 6 Ein IDS-Gast nimmt an einer Demo eines digitalen Workﬂows unter Verwendung von Straumann-Hardware und
-Software an Stand G080/J089, Halle 4.2 teil. An IDS guest takes part in a demo of a digital workﬂow utilising Straumann hardware and software at
Booth G080/J089, Hall 4.2. (© Koelnmesse) 7 Gäste der IDS haben Zugriﬀ auf die exklusivsten Messe-News, Programminformationen und Impressionen über die tagesaktuellen Ausgaben der today, die überall in der Koelnmesse erhältlich sind. Guests of IDS have access to the most exclusive fair
news, programme information and impressions via the daily issues of today, available throughout Koelnmesse. (© Robert Strehler) 8 XDepot bietet Endto-End-Lösungen für jeden Aspekt eines CAD/CAM-Workﬂows. XDepot oﬀers end-to-end solutions for every aspect of a CAD/CAM workﬂow. (© Koelnmesse) 9 Markus Sebastian ist Executive Vice President und Managing Director EMEA von Align Technology. Markus Sebastian is Align Technology’s
executive vice president and managing director, EMEA. (© Align Technology) 10 Pressevertreter sehen sich am Mittwochmorgen eine Demonstration
während der Presseveranstaltung von Align Technology an. Members of the press watch a demonstration during the Align Technology press event on
Wednesday morning. (© Align Technology)

Hidetaka Yoshikawa (Bildmitte), Chairman und CEO von Takara Belmont, rechts daneben Akira
Ogawa, Geschäftsführer Takara Belmont Frankfurt, und links Andreas Wilpert, Vertriebs- und
Marketingdirektor Takara Belmont Frankfurt, zusammen mit dem gesamten IDS-Messeteam.
Hidetaka Yoshikawa (centre), chairman and CEO of Takara Belmont; to his right, Akira Ogawa,
managing director of Takara Belmont Frankfurt in Germany; and to his left, Andreas Wilpert, sales
and marketing director of Takara Belmont Frankfurt, together with the entire IDS exhibition team.

40th International Dental Show 2023 • 16. März 16 March

[7] =>

Sca
an me

zum Pro
oblem
m

Unnütze Biofilmremovings, Stillstand der Einheiten und hohe Reparaturkosten bis zu 10.000 € p.a.
verursachen Dir Wasserschmerzen. Komplexe Wasser-Hygieneprobleme und nicht mehr verkehrsfähige Desinfektionsmittel im Bereich Trinkwasser, Abwasser, Prozesswasser und Medizinprodukte
gefährden Deinen Praxisbetrieb.
„Erfolgreiche Problemlösung heißt
zunächst Problemverständnis. Wir
haben 13 Hygieneprobleme identifiziert
und allein 5 davon betreffen jede
zahnmedizinische Einrichtung in
Deutschland. Diese Probleme sind schnell
lösbar.“
Jan Papenbrock
Geschäftsführer & Co-Gründer BLUE SAFETY GmbH

SAFEDENTAL löst Wasserschmerzen. Unser
Hygienesystem tausendfach erfolgreich umgesetzt.

Scan me

zur Lösung

Für die nachhaltige Lösung Deiner Wasser-Hygieneprobleme haben wir patentierte Technologien,
Medizinprodukte und Lösungsstrategien entwickelt. Wir sind Dein Ansprechpartner für alle Fragen
rund um Hygiene. Weniger technische Störungen, Ausfall, geringere Reparturkosten und ein einfaches
System sind das Ergebnis.
„Die 12-jährige Expertise unserer BLUE
SAFETY GmbH löst mit dem SAFEDENTAL
System Deine Wasser-Hygieneprobleme
aus rechtlicher, technischer, wissenschaftlicher und wirtschaftlicher Sicht.“
Jan Papenbrock
Geschäftsführer & Co-Gründer BLUE SAFETY GmbH

Online www.bluesafety.com/SAFEDENTAL
WhatsApp 0171 991 00 18
Fon 0251 92 77 85 4-0
BLUE SAFETY auf der IDS in Köln.
Innovations-Halle 2.2
Stand A 30 + B 49

Scan me

zum Erstgespräch

[8] =>

interview

Sicherheit, Flexibilität und Einfachheit –
NiTi-Feilen für jeden Wurzelkanal
Safety, flexibility and simplicity—NiTi files for every root canal
Ein Interview über das MANI-Dentalportfolio und das Feilensystem JIZAI. An interview about MANI’s dental portfolio and its JIZAI file system.
Mit einem Vertrieb in über 120 Ländern ist der japanische Hersteller
MANI eines der größten asiatischen
Medizinunternehmen. Zum umfangreichen Portfolio des Unternehmens
gehören auch Endodontie-Instrumente.
1956 gegründet, blickt MANI stolz
auf eine lange Geschichte in Forschung, Innovation und Qualität zurück. Im Interview sprechen Shuhei
Takahashi, Manager MANI European
Business Development bei der GDF
Gesellschaft für dentale Forschung
und Innovationen, und Dr. Ralf
Schlichting, Vorstandsmitglied der
Deutschen Gesellschaft für Endodontologie und zahnärztliche Traumatologie, über die Dentalsparte von
MANI und speziell über das Endodontie-Feilensystem JIZAI.
Herr Takahashi, MANI hat als Hersteller für medizinische Instrumente
einen eigenen dentalen Bereich mit
dem Schwerpunkt Endodontie entwickelt. Bitte stellen Sie das Portfolio kurz vor!
Wir entwickeln und produzieren
seit Jahren chirurgische Nadeln aus
Edelstahl. Nachdem wir reichlich Er-

Rolle – einerseits in Bezug auf das
Feilendesign und die einzigartige
Wärmebehandlung der JIZAI-Feilen,
andererseits standen wir für die klinische Performance und Haptik der Feilen in engem Kontakt mit versierten
Endodontologen. MANI ist stolz darauf, dass bereits vor dem oﬃziellen
Launch der Feilen erste universitäre
Studien durchgeführt wurden, die im
Vergleich mit Mitbewerbern sehr positiv ausﬁelen. So konnten wir sicherstellen, dass wir ein bereits wissenschaftlich überprüftes und ausgereiftes Produkt anbieten können.

rungen sind so positiv, dass ich heute
so gut wie alle Fälle in unserer auf
Endodontie limitierten Praxis mithilfe des JIZAI-Feilensystems löse. Es
sind drei Aspekte, die mich besonders beindrucken: die hohe Behandlungssicherheit, die herausragende
Flexibilität – gerade bei größeren Feilen – und die sehr exakte Beibehaltung der Kanalanatomie, was ein
möglichst zahnsubstanzschonendes
Arbeiten ermöglicht. Diese Faktoren
konnten in unabhängigen, bereits
veröﬀentlichten Studien nachgewiesen werden.

Herr Dr. Schlichting, es gibt eine
große Vielfalt an Feilen für die Wurzelkanalaufbereitung. Was macht für
Sie ein optimales Feilensystem aus?
Bei der Endodontie handelt es
sich um eine komplexe Angelegenheit. Wir haben es auf der einen Seite
mit unterschiedlichen und zum Teil
anspruchsvollen Anatomien zu tun.
Auf der anderen Seite stehen die biologischen Ziele unserer endodontischen Therapie, also die Entfernung
inﬁzierter Gewebe und komplexer mikrobiologischer Gebilde. Je besser es

Was unterscheidet die JIZAI-Feilen
von anderen Feilensystemen, die Sie
im Praxisalltag einsetzen?
Den größten Unterschied macht
meiner Meinung nach unter anderem
die hervorragende Flexibilität auch
bei größeren Feilengrößen wie etwa
die 30.04 oder 35.04. Viele Feilen anderer Hersteller haben bei kleinen
Feilengrößen bis etwa ISO 25 durchaus zufriedenstellende Flexibilität.
Diese nimmt aber bei größeren Feilen
dramatisch ab. Daraus resultiert die
Empfehlung, gekrümmte Kanäle nur
mit geringen Aufbereitungsgrößen
aufzubereiten. Bezugnehmend auf die
eben erwähnten biologischen Ziele
ist dieser Ansatz in meinen Augen
falsch. Zahlreiche Studien haben gezeigt, dass eine minimale Aufbereitungsgröße notwendig ist, um eine
suﬃziente Reinigung sowohl mechanisch als auch mit Desinfektionslösungen zu erzielen. Mit dem JIZAISystem ist, selbst bei sehr gekrümmten Kanälen, eine Aufbereitung bis
30.04 und in den meisten Fällen sogar bis 35.04 möglich. Ein weiterer
Vorteil ist, dass alle Feilen mit der
gleichen Drehzahl von 500/min und
einem Torque von 3 Ncm eingesetzt
werden können, was das Switchen
zwischen unterschiedlichen Feilen
unnötig macht.

Zahnarzt Dr. Ralf Schlichting (links) ist überzeugter Anwender der JIZAI-Feilen von MANI. Zusammen mit Shuhei Takahashi, Manager MANI European Business Development bei der GDF Gesellschaft für dentale Forschung und Innovationen, stellt er das System im Interview vor.
Dentist Dr Ralf Schlichting (left) is a convinced user of MANI’s JIZAI ﬁles. Together with Shuhei
Takahashi, manager of MANI’s European business development at its subsidiary the Gesellschaft
für dentale Forschung und Innovationen (society for dental research and innovation), he introduces the system in this interview.

fahrung mit unserer einzigartigen
Technologie gesammelt hatten, entschieden wir uns, unser Know-how
im Dentalbereich einzusetzen und
hochwertige Produkte herzustellen.
Wir führen endodontische Instrumente, aber auch Rotationsbohrer,
wobei die endodontischen Feilen das
Hauptgeschäftsfeld darstellen. Der
MANI-Markenname ist im Bereich
der endodontischen Feilen wie MANI
K-Files, H-Files, RT-Files und D-Finders
weltweit etabliert und anerkannt.
JIZAI ist MANIs neuestes rotierendes NiTi-System zur Wurzelkanalaufbereitung. Wie wurde es entwickelt?
Das JIZAI-Feilensystem wurde von
unserer Entwicklungsabteilung in enger Zusammenarbeit mit Endodontologen aus Hochschulen und Spezialistenpraxen entwickelt. Dabei spielte
die klinische Forschung eine zentrale

uns gelingt, diese biologischen Ziele
zu erreichen, umso erfolgreicher werden wir beim Erhalt natürlicher
Zähne sein. Ob es das optimale Feilensystem jemals geben wird, wage ich
zu bezweifeln. Aber es gibt ein paar
Anforderungen, die ich heute unbedingt erfüllt haben möchte: ein Feilensystem sollte maximale Behandlungssicherheit und bestmögliche
Flexibilität bieten sowie so minimalinvasiv wie möglich sein, es ermöglichen, die ursprünglichen Kanalanatomie beizubehalten und einfach in
den Behandlungsablauf integrierbar
sein.
Welche Erfahrungen haben Sie mit
dem JIZAI-Feilensystem in der Praxis gemacht?
Ich bin nun schon über einen
sehr langen Zeitraum mit dem JIZAIFeilensystem vertraut. Meine Erfah-

Anmerkung der Redaktion: Weitere Informationen über MANI sind unter www.mani.co.jp/en
verfügbar. IDS-Besucher haben die Möglichkeit,
am Stand des Unternehmens (H019) in Halle 10.1
mehr über das Portfolio von MANI und die neuen
JIZAI-Feilen zu erfahren.

Its products being distributed to
over 120 countries, the Japanese manufacturer MANI is one of the largest
companies in the Asian medical industry, and its extensive portfolio includes
endodontic instruments. Founded in
1956, the company proudly looks back
on a long history of research, innovation and quality. In this interview,
Shuhei Takahashi, manager of MANI’s
European business development at its
subsidiary the Gesellschaft für dentale Forschung und Innovationen (society for dental research and innovation), and Dr Ralf Schlichting, board
member of the Deutsche Gesellschaft
für Endodontologie und zahnärztliche
Traumatologie (German society for endodontics and dental traumatology),
talk to Dental Tribune International
about MANI’s dental products and its

Die JIZAI-Feilen von MANI. The JIZAI ﬁles from MANI.

JIZAI endodontic ﬁle system in particular.
Mr Takahashi, MANI has its own
dental division with a focus on endodontics. Could you briefly introduce
this product portfolio?
We have been developing and producing medical stainless-steel needles
for many years. After gaining signiﬁcant experience with our unique technology, we decided to apply our expertise to high-quality products for the
dental market. Today, MANI oﬀers endodontic instruments and rotary burs.
Our endodontic ﬁles, such as MANI
K-Files, H-Files, RT ﬁles and D Finders,
are established and recognised MANI
brand names around the world.
JIZAI is MANI’s latest rotary nickel–
titanium (NiTi) system for root canal
preparation. How was this system
developed?
The JIZAI ﬁle system was developed by our research and development department in close collaboration with endodontists from universities and specialist practices. Naturally,
clinical research played a central role
in the development with regard to ﬁle
design and the unique heat treatment
of the JIZAI ﬁles, and we worked
closely with experienced endodontists
in order to enhance the clinical performance and feel of the ﬁles. In particular, MANI is proud of the fact that
the ﬁrst university studies were carried out even before the oﬃcial launch
of the JIZAI ﬁles, the results of which
were very positive overall compared
with our competitors. We wanted to
ensure that we could oﬀer a wellengineered product that had already
been scientiﬁcally tested.
Dr Schlichting, the dental market
offers a variety of file systems for
root canal preparation. What are the
features of an optimal file system in
your opinion?
Endodontic treatment is very
challenging, as we have to deal with
many diﬀerent and sometimes very
demanding anatomies. The second
challenge we face is achieving the biological goal of endodontic therapy,
namely the removal of infected tissue
and complex microbiological structures such as bioﬁlm. The preservation of natural teeth largely depends
on how well we are able to achieve
this biological goal. I doubt that there

40th International Dental Show 2023 • 16. März 16 March

will ever be the optimal ﬁle system.
However, there are some requirements that I would like to have fulﬁlled: a ﬁle system must ensure maximum treatment safety, be as ﬂexible
and minimally invasive as possible,
allow retention of the original root canal anatomy and be easy to integrate
into the treatment workﬂow.
What is your experience with the
JIZAI files in practice?
I have been familiar with the JIZAI
ﬁle system for a very long time. Owing
to only positive experiences, we now
treat almost all cases with this ﬁle
system in our practice, which is limited to endodontics. There are three
aspects that particularly impress me:
the high degree of treatment safety,
the outstanding ﬂexibility—especially
with larger size ﬁles—and the very precise retention of the canal anatomy,
which allows us to preserve as much
tooth substance as possible. These
factors have also been demonstrated
in independent studies.
What distinguishes the JIZAI files
from other file systems that you use
in daily practice?
In my opinion, one of the major
diﬀerences is the excellent ﬂexibility,
even with larger ﬁles such as the
30/0.04 and 35/0.04. Small size ﬁles
of up to about ISO 25 from other manufacturers have suﬃcient ﬂexibility;
however, ﬂexibility decreases dramatically with larger size ﬁles. Therefore,
it is recommended to prepare curved
canals only with small ISO size ﬁles.
With regard to the biological goal of
endodontic treatment, this approach
is wrong in my opinion. Numerous
studies have shown that a certain
minimum preparation size is necessary to achieve adequate cleaning,
both mechanically and with disinfectant solutions. With the JIZAI system,
even very curved canals can be
shaped up to 30/0.04 and in most
cases even up to 35/0.04. Another
advantage is that all the ﬁles can
be used at the same speed of 500 rpm
and a torque of 3 Ncm, eliminating
the need to switch between diﬀerent
ﬁles.
Editorial note: More information
about MANI can be found at www.
mani.co.jp/en. IDS visitors can learn
more about MANI’s portfolio and
the new JIZAI ﬁles at the company’s
booth (#H019) in Hall 10.1.

Complete
interview

[9] =>

vĞƵ

h
j
Å

Åjh
±ƭƵĶĞŦśŲơĞHóƙďóŦƖóơơƵŦķǍŲŦ
Ȑʊɯʊ(ȓŤŃƭ¾ŃĞĶĞŦľăƙƭƵŦķ
ÞŃĞɼơŤóƙƭɽėŃĞ±Ťóƙƭ!ľƙŲŤóƭŃĐ¾ĞĐľŦŲśŲķǔ
ǍŲŦ¾ŲŘƵǔóŤóǎŃƙŘśŃĐľŃơƭɏǞĞŃķƭơŃĐľĞƙơƭóƵĶ(óƵĞƙɏ
ėĞŦŦėŃĞơƭƙƵŘƭƵƙĞśśĞHóƙďĞɏėŃĞóƵơėĞŦơƖľăƙŃơĐľĞŦ
HƻśśŘŽƙƖĞƙŦĞŦƭơƭĞľƭɏƖóơơƭơŃĐľŦŃĐľƭŦƵƙĞŃŦŤóśŃķ
ďĞŃėĞƙHƻśśƵŦķơśĞķƵŦķóŦėŃĞŕĞǎĞŃśŃķĞîóľŦĶóƙďĞ
óŦɏơŲŦėĞƙŦƭóķƭăķśŃĐľóƵĶơvĞƵĞɔ1ķóśɏŲďėŃĞîăľŦĞ
ķĞďśĞóĐľƭǎĞƙėĞŦŲėĞƙŦóĐľėƵŦŘĞśŦɔ

UľƙîóľŦǍĞƙăŦėĞƙƭơŃĐľɏtvU!P©t
ƖóơơƭơŃĐľóŦɯơŲķĞľƭ!ľóŤăśĞŲŦĞȅĞŘƭ
ŃŦÝŲśśĞŦėƵŦķɑ

tĞľƙƵŦƭĞƙ
ȱ
ǎǎǎɔŲŤŦŃĐľƙŲŤóɔėĞɚďƵśŘ

ĞơƵĐľĞŦ
±ŃĞƵŦơɎ
PóśśĞȐȏɔȐ
±ƭóŦėȓȏ
ŲľŦĞŘƻŦơƭśŃĐľĞHóƙďƖŃķŤĞŦƭĞ
ƖóơơƭơŃĐľɼóƵƭŲŤóƭŃơĐľɽėĞƙîóľŦĶóƙďĞóŦ

ŃơItɯĶƙĞŃĞHŲƙŤƵśŃĞƙƵŦķ

ĶƻƙĞŃŦĞďĞơơĞƙĞ ŃŲŘŲŤƖóƭŃďŃśŃƭăƭ

ŘĞŃŦĞ(ĞĐŘơĐľŃĐľƭŦŲƭǎĞŦėŃķ
ľĞƙǍŲƙƙóķĞŦėĞ ĞśóơƭďóƙŘĞŃƭ

[10] =>

news

3D-Drucklösung für komplett digitale Integration
3D printing solution for complete digital integration
SprintRay kündigt neue End-to-End-Workflows für dentalen 3D-Druck an. SprintRay announces new dental 3D-printing end-to-end workflows.
Mit einem Fokus auf dentalem 3DDruck entwickelt SprintRay seine
Technologie und Produkte ständig
weiter, um Dentalpraxen und -labors
seine einzigartigen, reibungslosen
Workﬂows zur Verfügung zu stellen.
Am Mittwoch stellte das Unternehmen seine neuen Produkte auf einer
Pressekonferenz vor, auf der auch
der weltweite Markenbotschafter von
SprintRay, der achtfache Olympiasieger und Weltrekordhalter im 100-Meter-Sprint Usain Bolt, zu Gast war.
„Der Dentalbereich ist unsere Leidenschaft und die Unterstützung unserer Kunden mit modernster Technologie und Software für einen allumfassenden Workﬂow ist das Ziel, auf das
wir Tag für Tag mit Bolt-Geschwindigkeit zusprinten“, sagte Amir Mansouri,
Geschäftsführer von SprintRay.
Mit einem umfassenden Produktangebot an 3D-Druckern, einem automatischen Wasch- und Trocknungssystem und einem Härtungssystem
bietet SprintRay intuitive und zuverlässige 3D-Drucklösungen exklusiv für
Zahnmedizinerinnen und Zahnmediziner. Die intelligente Slicing-Software
RayWare, ein breites Angebot an
SprintRay-Harzen, validierte Materialpartnerharze und Cloud Design Ser-

vices machen SprintRay zum Partner
der Wahl für Zahnarztpraxen und Labors auf der ganzen Welt. SprintRays
CloudDrive ist ein Integrationstool,
das alle intraoralen Scans an einem
Ort speichert und organisiert, um den
Zugriﬀ und die weitere Verwendung
in Design-Software zu vereinfachen.
Die neuen, intelligenten Funktionen
der 3D-Drucker-Produktreihe Pro S ermöglichen einen verbesserten Workﬂow und machen die Nutzung der
Drucker noch einfacher. Die Drucker
verfügen über intelligente Sensoren,
die die Druckvorbereitung unterstützen und Benutzerfehler verhindern.
Darüber hinaus sorgen die beheizte
Druckplattform, der Harzbehälter und
die neuartige Software für überragende Genauigkeit und dank der Funkidentiﬁzierungstechnologie ist der
Pro S in der Lage, die Lebensdauer jedes Harzbehälters zu verfolgen.
Zum Abschluss des 3D-DruckWorkﬂows kommt die neueste Postpolymerisationseinheit von SprintRay
zum Einsatz, ProCure 2, die eine erhebliche Reduzierung der Polymerisationszeiten ermöglicht. Während die
Polymerisation von Kronen früher
40 Minuten in Anspruch nahm, ist
dieser Schritt nun in weniger als

2 Minuten erledigt. Zur Verbesserung
der Eﬃzienz hat der Nutzer die Wahl
zwischen verschiedenen voreingestellten Polymerisationsproﬁlen.
Neben Hardware- und SoftwareVerbesserungen hat SprintRay neue EUzertiﬁzierte Materialien eingeführt.
With a focus on dental 3D printing,
SprintRay is continuously developing
its technology and products to deliver
its unique frictionless workﬂows to
dentists and laboratories. On Wednesday, the company presented its new
products at a press conference, which
was also joined by SprintRay’s global
brand ambassador, Usain Bolt, an
Olympic champion and world record
holder in the 100 m sprint.
“Dental is our passion and supporting our customers with advanced
technology and software for a comprehensive workﬂow is the goal that we
sprint to everyday, at Bolt speed,” said
SprintRay CEO Amir Mansouri.
With a full product portfolio of 3D
printers, automated washing and drying system and post-curing system,
SprintRay oﬀers intuitive and reliable
3D-printing solutions exclusively for
dental professionals. The smart slicing software RayWare, an extensive of-

Von links/From left: Amir Mansouri, CEO SprintRay, Usain Bolt und Holger Emmet, Head of Marketing Europe.

fer of SprintRay resin, validated material partner resins and Cloud Design
Services make SprintRay the partner
of choice for dental practices and labs
around the world. SprintRay’s CloudDrive is an integration tool that will
store and organise all intra-oral scans
in one place, thus facilitating access
and further use in design software.
The new intelligent features of the
Pro S range of 3D printers oﬀer an upgrade in workﬂow and make the printers even easier to use. The printers
have smart sensors that support printing preparation and prevent user error.
Additionally, the heated printing platform,

resin tank and novel software deliver
exceptional accuracy, and radio-frequency
identiﬁcation technology allows Pro S
to track the lifetime of each resin tank.
To ﬁnish oﬀ the 3D-printing workﬂow, SprintRay,s latest postpolymerising unit, ProCure 2, is used, which
signiﬁcantly reduces polymerisation
times. Whereas crowns used to take
40 minutes to polymerise, they now
take less than 2 minutes. For improved
eﬃciency, users can choose from a selection of preset polymerisation proﬁles.
Besides the hardware and software upgrades, SprintRay has introduced new EU-certiﬁed materials.

Amann Girrbach bietet den komplett digitalen Workflow
Amann Girrbach offers complete digital workflow
Expertenpanel diskutiert Komplettystem mit hoher Prozesssicherheit. Expert panel discusses full system that ensures high process safety.
Der Dental-CAD/CAM-Technologiespezialist Amann Girrbach hielt am
Mittwoch seine IDS-Pressekonferenz
ab. Sie fand in Form einer ExpertenPodiumsdiskussion statt und wurde
von Dr. Caroline Gommel moderiert.
Das Gremium bestand aus Experten
von Amann Girrbach und langjährigen Anwendern der Amann GirrbachProdukte im klinischen und im Laborumfeld.
Dr. Wolfgang Reim, CEO von
Amann Girrbach, erklärte vor internationalen Medienvertretern, dass das
spezielle Angebot des Unternehmens
für Dentalteams die gesamte zahnärztliche Prothetikkette abdeckt und
digitale Workﬂows beinhaltet, die die
langjährigen interdisziplinären Grenzen zwischen Praxis und Labor aufheben. „Dies verbessert die Kommunikation und Zusammenarbeit zwischen
beiden mit validierten digitalen Arbeitsabläufen, die eine hohe Prozesssicherheit und Reproduzierbarkeit gewährleisten“, sagte Dr. Reim und fügte
hinzu, dass das letztendliche Ergebnis
eine wirtschaftlichere Arbeitsweise sei.
Christian Ermer, Vice President für
Marketing und Digital des Unternehmens, und Falko Noack, Vice President für Forschung und Entwicklung,
gaben dem Publikum einen Blick hinter die Kulissen der Produktentwicklung des österreichischen Unternehmens und gaben Updates zur Produktpalette und zu Lösungen, die sich unter dem Firmenmotto „Connect To The

Dr. Wolfgang Reim, CEO Amann Girrbach.

„Connect To The (Work-)Flow“ ist das IDS-Motto von Amann Girrbach.
“Connect To The (Work-)Flow” is Amann Girrbach’s motto for IDS.

(Work-)Flow“ vereinen. Auf die Frage,
wie die Zahnarztpraxis in 20 Jahren
aussehen könnte, sagte Ermer, die Antwort sei während der Podiumsdiskussion auf der Bühne zu sehen: vernetzte,
kollaborative, intuitive digitale Lösungen, die die Zusammenarbeit verbessern
und disziplinäre Gräben überwinden.
Ergänzt wurde das Referentenpanel durch Dr. Cyrus Alamouti, Kölner
Zahnarzt und Branchenmentor, sowie
die Zahntechnikerin und Musikerin
Sina Moghadam. Laut Moghadam ist
es Amann Girrbach gelungen, Labor
und Praxis innerhalb eines funktionierenden digitalen Workﬂows zu verbinden: „Mission completed“, sagte er.
Dr. Alamouti und Moghadam machten deutlich, dass die Cloud-Plattform
des Unternehmens, AG.Live, für die
Zusammenarbeit zwischen Zahnarzt-

praxen und Laboren äußerst vorteilhaft ist.
Amann Girrbach freut sich, heute
um 13:00 Uhr zum Team-Talk am
Stand des Unternehmens (Halle 1.2,
Stand C040/D041) Dentalproﬁs begrüßen zu dürfen. Experten aus unterschiedlichen Fachgebieten stehen
für Fragen zum Portfolio von Amann
Girrbach sowie zu aktuellen und
kommenden Entwicklungen in der
Digitalen Zahnheilkunde zur Verfügung.
Dental CAD/CAM technology specialist Amann Girrbach held its IDS
2023 press conference on Wednesday.
It took the form of an expert panel discussion and was moderated by Dr
Caroline Gommel. The panel consisted
of Amann Girrbach’s own experts and

longtime users of its products in both
clinical and laboratory settings.
Dr Wolfgang Reim, CEO of Amann
Girrbach, explained to international
media representatives that the company’s special oﬀering for dental teams
covers the entire dental prosthetics
chain and that it includes digital workﬂows that break down the long-standing interdisciplinary boundaries between dentists and dental technicians.
“This enhances communication and
collaboration between the two with
validated digital workﬂows that ensure
high process safety and reproducibility,” Dr Reim said, adding that the ultimate result was a more economical
way of working.
Christian Ermer, vice president of
marketing and digital at the company,
and Falko Noack, vice president of re-

40th International Dental Show 2023 • 16. März 16 March

search and development, gave the audience a behind-the-scenes look at product development at the Austrian company and provided updates on the suite
of products and solutions that combine
under the company’s motto “Connect
To The (Work-)Flow”. When asked what
dental practice could look like 20 years
from now, Ermer said the answer could
be seen on-stage during the panel discussion: networked, collaborative, intuitive digital solutions that enhance
collaboration and break down disciplinary divides.
Complementing the speaker panel
was Dr Cyrus Alamouti, a Cologne
dentist and industry mentor, and
dental technician and musician Sina
Moghadam. According to Moghadam,
Amann Girrbach has succeeded in
connecting laboratory and practice
within a functioning digital workﬂow:
“Mission completed,” he said. Dr Alamouti and Moghadam made it clear
that the company’s cloud platform,
AG.Live, is extremely beneﬁcial for the
collaboration between dental practices and laboratories.
Amann Girrbach is looking forward to welcoming dental professionals to its Team-Talk event today at 13:00
at the company’s booth (Hall 1.2, Booth
C040/D041), where experts from the
company and a variety of ﬁelds will be
available to answer questions about
the Amann Girrbach portfolio and about
current and upcoming developments
in digital dentistry.

[11] =>

Limited time offer!
Visit us at Hall 11.3 Stand G010-H029

Do you want to get rid of complicated
processes, save time and money?
Neoss® Digital Workﬂow
For over 20 years, Neoss has offered intelligent solutions that are intuitively easy to
use. Our products allow dental professionals to provide reliable and cost-effective
treatments to their patients with predictable long-term results. Utilizing our simple
digital workﬂow into your daily practice will save you time and money, while
increasing predictability. It will help you deliver the best functional and esthetic
outcomes for your patients.

1. Predictable and simpliﬁed
implant treatment

6. Predictable

2. Simpliﬁed

long-term
esthetics

healing

3D

5. Digital
prosthetics

3. Digital
impression

4. Prosthetic
implant

Digital
workﬂow

Neoss GmbH

•

Im Mediapark 5b

•

50670 Köln

•

T +49 221 96980 10

•

E neoscan.support.de@neoss.com

[12] =>

news

An vorderster Front im 3D-Druck Leadership in 3D printing
Academy for Dental 3D Printing auf der IDS vorgestellt. Academy for Dental 3D Printing introduced at IDS.
Dental Tribune International war

gestern Gastgeber für die Gründungsversammlung der International Academy for Dental 3D Printing
(iad3Dp). Die neue Organisation versteht sich als oﬀenes Forum für freie
Diskussionen und für die Präsentationen neuer Ideen auf dem Gebiet
der additiven Herstellungsverfahren
in der Zahnheilkunde.
Die schnelle Verbreitung und Ak-

bezogenen und klinischen Standards
unterstützt. Außerdem soll sie die
Grundlagen für eine umfassende Ausbildungsplattform schaﬀen, auf der
dann Zahnärztinnen und Zahnärzte
sowie Zahntechnikerinnen und Zahntechniker auf der ganzen Welt geschult werden können. Die iad3Dp
wurde auf Initiative von Chefredakteur Dr. George Freedman und weiteren Mitgliedern der Redaktion der

Die Gäste hatten die Möglichkeit, die neueste Ausgabe des 3D printing-Magazins zu lesen.
Guests had the opportunity to read the latest issue of the 3D printing magazine.

zeptanz der 3D-Drucktechnologie auf
vielen Gebieten der Dentaltechnik
hat uns deutlich vor Augen geführt,
dass Bedarf an einer Organisation besteht, die die Branche bei der Entwicklung von produktions- und labor-

Publikation 3D printing―international
magazine of dental printing technology geschaﬀen.
Vorgesehen ist eine Organisation
mit bezahlbarer und oﬀener Mitgliedschaft, die die folgenden wichtigen

Know-how-Bereiche abdecken soll:
Hardwarefachleute, Softwarefachleute,
Techniker und alle, die in der Zahnheilkunde tätig sind. Die iad3Dp hat
bereits Fühler zu akademischen Einrichtungen ausgestreckt, die als Partner für Tagungen sowie für Gemeinschaftsprojekte auf den Gebieten
Forschung und Praxis infrage kommen. Die neue Akademie hat außerdem Personen und Unternehmen
kontaktiert, die an diesem schnell
wachsenden Teilbereich der Zahnheilkunde interessiert sind.
„Da die 3D-Drucktechnik in der
Zahnheilkunde so innovativ ist und
so viele bahnbrechende Neuerungen
verspricht, brauchen wir eine Plattform, auf der sich oﬀene und fantasievolle Geister austauschen können. Sie
soll risikofreudige Köpfe ermutigen,
auf der Grundlage wissenschaftlicher
Erkenntnisse etabliertes Wissen und
bekannte Verfahren zu hinterfragen.
Die neue Organisation muss sich ausschließlich dem 3D-Druck in der Zahntechnik widmen“, erklärte Dr. Freedman. „Die iad3Dp bietet ein oﬀenes
Forum für freie Diskussionen und
die frühzeitige Präsentation neuer
Ideen, auch wenn sie gewagt erscheinen.“
Yesterday, Dental Tribune International hosted the founding meeting of
the International Academy for Dental
3D Printing (iad3Dp). The goal of the
new organisation is to create an open
forum for free discussions and pres-

Dr. George Freedman.

entations of new ideas in the domain of
additive manufacturing in dentistry.
The rapid uptake and acceptance
of 3D-printing technologies in a wide
range of dental procedures indicated
the need for an organisational structure to assist in the development of
manufacturing, laboratory and clinical standards and to begin the formulation of a comprehensive educational
platform that could serve to train dentists and technicians worldwide. The
iad3Dp was founded on the initiative
of Dr George Freedman, editor-in-chief
of the 3D printing―international magazine of dental printing technology and
members of the editorial board of the
magazine.
The organisational model includes
an aﬀordable, open membership that
covers the following crucial ranges of
expertise: hardware experts, software
experts, technicians and dental profes-

sionals. The iad3Dp has already developed ties with academic institutions
as partners for symposia, research and
professional collaboration. The newly
established academy has also contacted
individuals and companies with an interest in this rapidly developing area
of dentistry.
“Since dental 3D printing is so innovative, so promising and so disruptive, it demands a platform that engages
open minds and imaginative spirits and
empowers science-based risk-takers who
will challenge conventional wisdom
and established practice. Thus, it was
essential that a new organisation, one
that is dedicated solely and exclusively
to dental 3D printing be convened,”
Dr Freedman said. “The iad3Dp is an
organisation that oﬀers an open forum
for free discussions and timely presentations of new ideas, even if they
seem far-fetched,” he added.

3M präsentiert neueste Technologien in der Digitalen Zahnheilkunde
3M showcases latest technologies in digital dentistry
Wissenschaftsbasierte Lösungen auf der IDS. Science-driven solutions at IDS.
3M stellt auf der IDS seine neues
ten digitalen Technologien vor und
veranstaltet mit seinen Technologiepartnern Vorträge und Produktvorführungen. Auf der IDS können Besucherinnen und Besucher mit den
Expertinnen und Experten von 3M
sprechen und einige der neuesten
Produkte des Unternehmens ausprobieren, die für direkte Restaurationsmaterialien und die Abdrucknahme
universell einsetzbar sind.
Diese universellen Lösungen, insbesondere die ﬂießfähigen Komposite
der Marke Filtek, die eine einwandfreie
Anwendung erlauben, ermöglichen
optimierte Workﬂows. Die kostenlosen
Vorträge und Produktdemonstrationen
umfassen direkte restaurative Behandlungen (Style Italiano, Bioclear), Lichtpolymerisation (CheckMARC) und Prothetik (Success Simpliﬁed).
„Wir freuen uns sehr, unsere Kunden, Partner und Interessenten aus
der Branche wieder auf dem weltweit
größten Dental-Event zu treﬀen“, sagte
Cagatay Guler, Vice President of Oral
Care bei 3M für die Region Europa, Naher Osten und Afrika. „Die enge Partnerschaft und der Dialog mit Zahnärzten waren der Ausgangspunkt jeder
3M-Innovation und ermöglichten 3MWissenschaft, die wirklich auf das Leben angewendet wird. Wir freuen uns
darauf, diese wissenschaftlich fundierten

Lösungen auf der IDS zu präsentieren
und Details zu vielen unserer bevorstehenden Innovationen bereitzustellen.“
„Wir freuen uns, dass wir dieses
Jahr ein 100-köpﬁges Team an unserem Stand haben und einige unserer
wichtigsten Technologiepartner hinzukommen werden“, fügte er hinzu.
Petri Talvitie, Vertriebsleiter für
Oral Care bei 3M für Nordeuropa,
kommentierte: „Besucher haben die
Möglichkeit, mehr über die Innovationen von 3M zu erfahren, mit denen
Benutzer alltägliche Herausforderungen leichter meistern können, und
Trends und Veränderungen in der Digitalen Zahnheilkunde zu diskutieren“, schloss er.
3M is showcasing its latest digital
dentistry technologies and hosting lectures and product demonstration sessions with its technology partners at
IDS.
At IDS, attendees can talk to 3M’s
product experts and try out some of
the company’s newest products, which
have universal application in direct restorative materials and impression
taking. These universal solutions, especially the Filtek brand ﬂowable composites that facilitate ﬂawless application, enable a tidy drawer and optimised
procedures.

Einladend, modern, urban: der 3M-Messestand (G090) in Halle 4.2 auf der IDS. Inviting, modern, urban: the 3M booth (#G090) in Hall 4.2 at IDS 2023.

The free lecture sessions and
product demonstrations cover direct
restorative treatments (Style Italiano,
Bioclear), light polymerisation (CheckMARC) and prosthodontics (Success
Simpliﬁed).
“We are extremely excited to
meet our customers, partners and
industry stakeholders again at the
world’s largest dental gathering,”
said Cagatay Guler, vice president of

oral care at 3M for the Europe, Middle East and Africa region. “The
close partnership and dialogue with
dental professionals have been the
starting point of each 3M innovation, enabling 3M Science that is
truly applied to life. We look forward
to showcasing these science-driven
solutions at IDS and providing details around many of our upcoming
innovations.”

40th International Dental Show 2023 • 16. März 16 March

“We are happy that this year we
have a 100-strong team at our booth
and will be joined by some of our key
technology partners,” he added.
Petri Talvitie, 3M oral care sales
leader for North Europe, commented:
“Visitors have an opportunity to learn
more about the 3M innovations that
allow users to master everyday challenges more easily and to discuss trends
and changes in digital dentistry.”

[13] =>

[14] =>

news

Smarte Software-Innovationen Smart software innovations
Carestream zeigt Vernetzung der Dentalwelt. Carestream shows how to connect the dental world.
Unter dem Motto „Connect to an
open, smarter World“, präsentierte
Carestream Dental ein stimmiges Konzept zur Implementierung eines intelligenten, digitalen Workﬂows beim
Pressetalk auf der IDS am Dienstagabend.
„Ob für eine einzige Praxis, ein
Praxisnetzwerk oder Dental Support
Organisations, Carestream Dental bietet individuelle Lösungen, die auf verschiedenste Anforderungen zugeschnitten werden können“, schilderte Roland
Schmidt, Regional Sales and Service
Director Central, East und North Cluster, beim IDS-Pressetalk.
Mit der neuen Funktion IO Scanner Link der CS Imaging 8-Software
von Carestream können Behandelnde
ihre Bildgebungsgeräte mit führenden
Intraoralscannern anderer Hersteller

wie Medit nutzen. Um seinen Kunden
noch mehr Flexibilität zu bieten, wird
Carestream seine Software über die
nächsten Monate für noch viele weitere öﬀnen.
Beim Pressetalk stellte das Unternehmen auch die Neo Edition seines
CS 7200 vor, das mithilfe seiner Scan &
Go-Technologie alltägliche Aufgaben
erleichtert und eine herausragende
Bildqualität liefert. Durch ein neues
Update ist das CS 7200 zusätzlich in
der Lage, Bilder von unterschiedlichen
Standorten in einem Gerät zu verarbeiten.
Um eine optimale Bildqualität zu
gewährleisten, sind alle Carestream
Dental-Produkte mit den smartesten
Softwarelösungen ausgestattet, die es
auf dem Markt gibt. Ein Beispiel ist AI
Insights, das zahnmedizinischem Fach-

personal auf Basis künstlicher Intelligenz ein leistungsfähiges Tool liefert,
mit dem sich unvollständige Röntgenbild-Ergebnisse zuverlässiger und genauer interpretieren lassen.
„Die Welt vernetzen und dabei
dennoch den individuellen Workﬂow
der einzelnen Praxis berücksichtigen:
Darum geht es uns bei Carestream
Dental. Und genau das zeigen wir auf
der IDS 2023“, fasste Robert Leonhardt, Verantwortlicher für Sales und
Marketing bei Carestream Dental, den
Pressetalk zusammen.
Under the motto “Connect to an open,
smarter world”, Carestream Dental
presented a coherent approach to implementing an intelligent, digital workﬂow at the media event at IDS on Tuesday evening.

Der Stand von Carestream (L040/M041) beﬁndet sich in Halle 10.2. The Carestream booth (#L040/M041) can be found in Hall 10.2.

Robert Leonhardt, Verantwortlicher für Sales und Marketing bei Carestream Dental, sprach
über die Ziele des Unternehmens.
Robert Leonhardt, who is responsible for sales and marketing at Carestream Dental, spoke about
the companys goals.

“Whether for a single practice, a
practice network or for dental support
organisations, Carestream Dental oﬀers
customised solutions that can be tailored to a wide range of requirements,”
said Roland Schmidt, regional sales
and service director Central, East and
North Cluster, at the IDS media event.
With the new IO Scanner Link feature for Carestream’s CS Imaging 8 software, practitioners can use their imaging equipment with leading intra-oral
scanners from other manufacturers
such as Medit. To oﬀer its customers
even more ﬂexibility, Carestream will
open its software to many more over
the coming months.
The company also presented the
Neo Edition of its CS 7200 at the media event, which—with the aid of its
Scan & Go technology—facilitates everyday tasks and delivers outstanding

image quality. Via a new update, the
CS 7200 is also able to process images from diﬀerent locations in the
one device.
To ensure optimal image quality,
all Carestream Dental products are
equipped with the smartest software
solutions available on the market. One
example is AI Insights, which provides
dental professionals with a powerful
artiﬁcial intelligence-based tool to
more reliably and accurately interpret
incomplete X-ray image results.
“Connecting the world while still
respecting the individual workﬂow of
each practice: that’s what we’re all
about at Carestream Dental. And that’s
exactly what we’ll be showing at the
IDS 2023,” said Robert Leonhardt, who
is responsible for sales and marketing
at Carestream Dental, summing up
the media event.

TePe bringt zwei neue Zahnpasta-Produktreihen auf den Markt
TePe launches new toothpaste range
TePe Daily und TePe Pure für jedes Mundbedürfnis. TePe Daily and TePe Pure for every oral care need.
Schonende Fluorid-Zahnpasta für
die ganze Familie, geeignet für empﬁndliches Zahnﬂeisch und trockene
Mundschleimhaut: Vorhang auf für
TePe Daily und TePe Pure, zwei Lösungen für unterschiedliche Bedürfnisse bei der Mundpﬂege und die
perfekte Ergänzung für die anderen
Produkte von TePe.
„Diese Zahnpasta ist eine natürliche Ergänzung für unsere Palette, und
die Branche wartet schon lange darauf. Dank der Vielfalt der Varianten
können Zahnärzte genau das empfehlen, was die Patienten brauchen und

bevorzugen. Die Produkte eignen sich
für empﬁndliche oder trockene Mundschleimhaut und für verschiedene Altersstufen, und sie kommen ohne überﬂüssige Zusätze aus“, erklärt Dr. Anna
Nilvéus Olofsson, Spezialistin für Kinderzahnheilkunde und Manager of Odontology and Scientiﬁc Aﬀairs bei TePe.
Das Sortiment von TePe für die
präventive Mundpﬂege beinhaltet eine
breite Palette von Zahnbürsten, Spezialbürsten und Geräten für die Reinigung der Zahnzwischenräume. Und so
ist auch die neue Zahnpastareihe dank
der speziell entwickelten Formel mit

ihren sorgfältig ausgewählten Inhaltsstoﬀen für die ganze Familie und für
Patienten mit empﬁndlicher oder trockener Mundschleimhaut geeignet. Die
Zusammenstellung ist vegan und wurde
in Schweden entwickelt. Die Verpackung ist recyclingfähig.
Das Sortiment wurde in Zusammenarbeit mit Experten aus dem Bereich der Zahnmedizin entwickelt und
in Schweden hergestellt. TePe verwendet recyclingfähige Materialien und erneuerbare Energie. Das Unternehmen
ist bestrebt, seinen CO2-Fußabdruck
immer weiter zu verkleinern und zu

1 Helen Richenzhagen (links/left), Global Sales Director TePe, Anne-Kristin Ottosson, Portfolio Director TePe.
2 Besucherinnen und Besucher der IDS in Halle 5.2 können mehr über TePe-Produkte erfahren. IDS visitors can learn more about TePe’s products in Hall 5.2.

einer gesünderen und nachhaltigeren
Zukunft beizutragen.
Die Reihe TePe Daily ist die richtige Wahl für die tägliche Zahnpﬂege
der ganzen Familie. Sie umfasst TePe
Daily für Erwachsene, TePe Daily Kids
und TePe Daily Baby. Alle Produkte
sind schwach schäumend und enthalten kein SLS.
TePe Pure ist die beste Wahl bei
empﬁndlicher und trockener Mundschleimhaut. Es gibt sie in den beiden
Varianten TePe Pure Unﬂavoured und
TePe Pure Peppermint; beide sind frei
von SLS, Schaumbildnern, Farb- und
Konservierungsstoﬀen.
A gentle ﬂuoride toothpaste for every
member of the family, for sensitive oral
mucosa or for dry mouth. Meet TePe
Daily and TePe Pure, the toothpaste options for diﬀerent oral care needs and
the perfect complement to TePe’s range
of oral care solutions.
“Toothpaste is a natural complement to our existing range and a longstanding request from the dental community. The diﬀerent varieties enable
dental professionals to tailor their recommendations according to the patient’s
needs and preferences, such as sensitive oral mucosa and dry mouth, but also
provide options for all ages without any
unnecessary additives,” said Dr Anna

40th International Dental Show 2023 • 16. März 16 March

Nilvéus Olofsson, a specialist in paediatric dentistry and manager of odontology and scientiﬁc aﬀairs at TePe.
TePe’s preventive oral care portfolio includes a wide range of toothbrushes,
special brushes and interdental cleaning devices. The new gentle toothpaste
range oﬀers options for the whole family as well as those with sensitive oral
mucosa and dry mouth, thanks to its
specially developed vegan formula with
carefully selected ingredients. The vegan formula was developed in Sweden,
and the toothpaste range—with recyclable
packaging—was developed in collaboration with dental experts and manufactured in Sweden. Using renewable
materials and energy, TePe aims to
continuously lower its carbon footprint
and contribute to a healthier and more
sustainable future.
The TePe Daily series is an everyday choice for every member of the
family. It includes TePe Daily for adults,
TePe Daily Kids and TePe Daily Baby.
All the toothpastes are low-foaming and
are free of sodium lauryl sulphate (SLS).
TePe Pure is the ideal choice for
sensitive oral mucosa and dry mouth.
It comes in two versions, TePe Pure
Unﬂavoured and TePe Pure Mild Peppermint. Neither contains SLS or other
foaming agents, colouring agents or
preservatives.

[15] =>

[16] =>

[17] =>

.QQMKPIHQTC
WPKSWGCPFGZEKVKPI
UECPGZRGTKGPEG
)%QHHGTUVJGYQTNFƂTUV#+DCUGFRCVGPVGFIGUVWTG
EQPVTQNNGFFGPVCN.CDUECPPGT6JG#CFXC.CD
UECPPGTQHHGTUCEQORNGVGN[PGYWUGTGZRGTKGPEG
PQVQPN[GZEKVKPIDWVCNUQGHƂEKGPVVJCPMUVQKVU
RCVGPVGFRTQLGEVKQPVGEJPQNQI[

2CVGPVGF
RTQLGEVKQP
VGEJPQNQI[
r 'ZEKVKPICPFWPKSWGWUGT

 GZRGTKGPEG
r 5ECPKPUVTWEVKQPURTQLGEVGF
 QPVJGQDLGEVU

#+DCUGF<CZKU
RQUKVKQPKPI
6JGU[UVGORNCVGRQUKVKQPU
KVUGNHCWVQOCVKECNN[DCUGFQP
VJGGNGOGPVVQDGUECPPGF
YKVJQWVJCPFNKPI

5CHGV[5RGGFCPFSWCNKV[
r $NWGNKIJVUCHGV[1RVKECN4CFKCVKQPENCUU
r CEEWTCE[CEEQTFKPIVQ+51
r UHWNNCTEJUECP
5QWTEG 2TCNN%(TKGOGN,&GPVCN&5ECPPGT#TKUMHCEVQT!
 
,1UUGQKPVGIT  55

)%'7412'08
KPHQIEG"IEFGPVCN
JVVRUYYYIEFGPVCNGWTQRG

[18] =>

industry

NEUE TECHNOLOGIEN UND HYGIENEKONZEPTE AN STÄNDEN VON BLUE SAFETY UND DENTAL.SHOP
renpotenzial für Patientinnen und
Patienten sowie das Praxisteam.

Zugelassene und kontinuierliche Trinkwasserdesinfektion für dauerhaften Erfolg

Neue Technologien und Hygienekonzepte erwarten Sie am gemeinsamen Stand von BLUE SAFETY und DENTAL.SHOP.

Der Dentalmarkt ist im Umbruch –
viele bekannte Wasserdesinfestionsmittel haben unter der Biozidverordnung ihre Verkehrsfähigkeit verloren. Jetzt braucht es neuartige Systeme und ein ausgefeiltes Konzept,
um langfristige ﬁnanzielle und gesundheitliche Folgeschäden zu verhindern.
Unbemerkt können sich über
das Jahr Keime in die Trinkwasserinstallationen einschleichen. Unbemerkt kam es aber auch zu einer
Veränderung der regulatorischen Vor-

gaben für deutsche Zahnarztpraxen.
Was bisher noch erlaubt war, stellt
heute eine wichtige Veränderung zu
den Fragen der Wasserhygiene dar.
Denn viele Wasserdesinfektionsmittel für Dentaleinheiten auf Basis von
Wasserstoﬀperoxid oder Biguanidin
haben ihre Verkehrsfähigkeit verloren. Umso schwieriger wird es, den
geltenden Hygieneanforderungen so
noch gerecht zu werden. Denn natürlich bilden sich in den Wasser
führenden Leitungen auch weiterhin aquatische Bioﬁlme. Besonders

ärgerlich wird es, wenn die Ablagerungen bis in die Instrumente reichen und diese verstopfen oder sogar Dentaleinheiten langsam zersetzen – horrende Reparaturkosten sind
die Folge. Auch das gesundheitliche
Risiko sollte nicht unterschätzt werden. Neben Kolibakterien und Pseudomonas aeruginosa gefährdet insbesondere Legionella pneumophila
die Gesundheit. Über Aerosole gelangen die Legionellen in die Atemwege
und können schwere Lungeninfektionen auslösen. Ein hohes Gefah-

PROZESSE VEREINFACHEN, GELD UND ZEIT SPAREN MIT DEM DIGITALEN WORKFLOW VON NEOSS SIMPLIFY PROCESSES, SAVE MONEY
AND TIME WITH DIGITAL WORKFLOW FROM NEOSS
Seit über 20 Jahren entwickelt
Neoss intelligente Lösungen, die es
Zahnärztinnen und Zahnärzten ermöglichen, ihren Patientinnen und
Patienten zuverlässige und kosteneﬃziente Behandlungen mit vorhersehbaren langfristigen Ergebnissen
anzubieten. Jetzt hat Neoss einen digitalen Workﬂow entwickelt, der von
allen Zahnärztinnen und Zahnärzten eingesetzt werden kann. Er besteht aus nur sechs einfachen Schritten, die Ihnen helfen, Zeit und Geld
zu sparen und gleichzeitig die Vorhersagbarkeit zu erhöhen, um die
besten funktionellen und ästhetischen Ergebnisse für Ihre Patientinnen und Patienten zu erzielen.
In diesem neuen Workﬂow ﬁnden Sie nicht nur unseren schnellen und präzisen Intraoralscanner
NeoScan 1000, sondern auch die exklusiven ästhetischen Heilungsabutments mit ScanPeg. Dabei handelt es
sich um eine Kombination aus Gingivaformer und Scanabutment in einer revolutionären 2-in-1-Lösung. Diese
vereinfachte, kosteneﬀektive Lösung
für genaues und müheloses intraora-

les Scannen spart nicht nur Zeit
und Geld, sondern ist auch
patientenfreundlich, da sie
eine hervorragende Ästhetik bietet und die Aufrechterhaltung der biologischen
Versiegelung während des
Scanvorgangs ermöglicht. Die Neoss
ästhetischen Heilungsabutments mit
ScanPeg sind nicht nur für den einmaligen Gebrauch erhältlich. Sie
können sie auch für das Scannen Ihrer Brückenrestauration verwenden.
Überzeugen Sie sich noch heute
am Neoss-Messestand.
For over 20 years, Neoss has developed smart solutions that allow
dental professionals to provide reliable and cost-eﬀective treatments to
their patients with predictable longterm results. Now Neoss has created
a digital workﬂow that all dental clinicians can implement. It consists of
just six easy steps that will help

them save time, money and at the
same time increase predictability
that deliver the best functional and
aesthetic outcomes for their patients.
In addition to the fast and precise impression tool NeoScan 1000, this
new workﬂow features exclusive integrated aesthetic healing and scan
abutment, the Neoss Esthetic Healing Abutment with ScanPeg.
The Neoss Esthetic Healing Abutments with ScanPeg is a combination
of healing abutment and scan abutment in a revolutionary two-in-one
solution. This is a simpliﬁed, cost-effective solution for accurate and effortless intra-oral scanning. Using
the healing abutments with ScanPeg
will help you save time and money.
They are also patient-friendly because they oﬀer optimal aesthetics
and help keep the biological seal intact during the scanning process.
This solution is not only available for
single use. You can also use it for
your bridge restoration scanning.
Make sure to check it out today
at the Neoss booth.

Die neueste SAFEWATER-Technologie basiert auf einer kontinuierlichen Trinkwasserdesinfektion und
ist zur Desinfektion von Wasser auch
in dentalen Behandlungseinheiten
unter der aktuellen Biozidverordnung zugelassen. Statt erst bei gravierenden Problemen wie mikrobiellen Kontaminationen zu handeln,
sorgt die zentral implementierte Anlage präventiv für eine eﬀektive Desinfektion und verhindert die Neubildung von Bioﬁlm. Der umfangreiche
Full-Service sorgt zudem für Entlastung im Praxisalltag.
Die SAFEBOTTLE ist das erste hygienisch – validiert gemäß DIN EN
ISO 17664 – aufbereitbare Druckﬂaschensystem seiner Art made in
Germany und setzt damit neue Maßstäbe. Die SAFEBOTTLE ist die hygienische Alternative für mit Pilzen befallene freie Fallstrecken und Mischkammern in Dentaleinheiten, die einer Kreuzkontamination von Aerosolen aus der Absauganlage im Stuhl
ausgesetzt sind. Hochwertigste Materialien und ein intelligenter Aufbau
sorgen außerdem für einen hohen

Hygienestandard und eine lange Lebensdauer. Dank neugewonnener
Arbeitssicherheit können Sie sich
besser auf Ihre eigentliche Tätigkeit
konzentrieren.

Neue Hygienekonzepte von
DENTAL.SHOP
Wer seine Desinfektionsmittel in
Zukunft lieber selbst herstellen will,
ist bei DENTAL.SHOP bestens aufgehoben. Innovative Qualitätsmanagement-Bausteine ermöglichen die RKIkonforme Desinfektion von Absauganlagen für mehr Umweltschutz.

Wasserhygiene endlich
sichtbar machen
Wie Sie mit dem Einsatz der
SAFEWATER-Hygienetechnologie
und SAFEBOTTLE Patientinnen und
Patienten für Ihr Praxisunternehmen
gewinnen, zeigen Ihnen die Wasserexperten des Medizinprodukteherstellers BLUE SAFETY auf der IDS.
Neben der Beratung locken limitierte
Sammeltassen. Ein Besuch lohnt
sich!

BLUE SAFETY, Germany
www.bluesafety.com
Hall 2.2
Booth A030/B049

DGSHAPE—“CONNECTED FOR INNOVATION”
The DGSHAPE crew is delighted
to be in Cologne for IDS 2023.
DGSHAPE is a wholly owned subsidiary of Roland DG—a leading digital printing company—and its roots
extend to the well-known Roland
brand, which has revolutionised the
music industry using digital technologies. Together, the Roland Group
provides products for digital artists
to shape their ideas and creativity.
Since its beginnings more than
20 years ago, DGSHAPE has come to
prominence in the dental industry.
The company believes that it takes
an artist to endeavour to achieve
maximum functionality and aesthetics for each tooth. For DGSHAPE, the
dental technicians and dentists who
strive each day to improve human
health and to design and enhance
smiles are indeed masters of their
artistic craft.
The company has been lucky
enough to meet many of the artists
who use its dental products and
solutions daily, and it has found
them to be inspired by the extraordinary qualities of the seen and un-

Neoss, Switzerland
www.neoss.com
Hall 11.3
Booth G010/H029

40th International Dental Show 2023 • 16. März 16 March

seen world. They believe in their
own powers of imagination and diligently pursue their vision in order
to create artwork that transcends
the status quo and shapes the future.
DGSHAPE supports them by embracing its brand vision of “Empowering
people to shape the future” and its
mission of “Make Innovation Make
Life Better”.
In its history, DGSHAPE has
taken on many challenges, and it
continues to develop innovative products, ranging from pen plotters to
digital printers, and from printers to
advanced CNC 3D milling machines.
Real innovation breaks with the
present and moves our minds towards the future.
Visit the company at IDS to ﬁnd
out more about how art is an essential part of its brand.

DGSHAPE, Belgium
www.dgshape.com
Hall 3.1
Booth K060/L069

[19] =>

[20] =>

industry

STRUCTURE OR PIGMENTS? HOW COLOUR IS CREATED WITH COMPOSITES
Those who treat their patients with
composite ﬁllings have probably already justiﬁed this by saying that it
is an aesthetically high-quality and
metal-free form of restoration. But is
this correct? Basically, composites
are made up of three components: an
organic resin matrix, inorganic ﬁllers
and a composite phase of silanes. If
you take a closer look at the composition of the organic matrix, you will
notice that, in addition to monomers,
initiators and stabilisers, it contains
dyes and pigments. While pigments
made of titanium dioxide and aluminium oxide are used for white colouring. Black, red or yellow colourings
can be achieved with iron oxide pigments. These are the shades that are
relevant to the colour range of human
teeth.

cause. This mechanism also underlies
the colouring of most composites. The
iron oxides contained in them, for example, reﬂect red or yellow wavelengths and thus provide the desired
colour tone.

Colour from structure
However, it is also possible to create colour without the addition of pigments. The decisive term in this context is “structural colour”. In contrast

to pigment colours,
they do not result
from the absorption
or non-absorption of
certain wavelengths
of light, but are created
based on certain surface
structures. The cause is
not chemical but physical. These
structures interact with the light
and give rise to colour, for example,
through interference or diﬀraction.

Structural colour in the
dental practice
In the ﬁeld of dental composites,
structural colour was used as the
main colour mechanism for the ﬁrst
time in 2019. Using Smart Chromatic Technology, the Japanese supplier Tokuyama succeeded in making the mechanism usable for its
universal composite Omnichroma.
The new ﬂowable version of this material, Omnichroma Flow BULK, now
also uses this technology and does
not require any artiﬁcially added
dyes or pigments. This is due to the
microstructure of the material. Of
particular importance in this con-

Just like leaves and
chlorophyll
But how exactly does colouring
with pigments actually work in composites? As with a plant, light with all
its wavelength ranges hits a leaf,
where it is largely absorbed by the
chlorophyll. Only the green wavelengths are reﬂected, which is why
we perceive the leaf as green. The colouring in this case has a chemical

text are the spherical ﬁllers
with controlled particle size and
structure. They create the structural
colour, which also reﬂects the surrounding tooth colour.
This results in a pronounced chameleon eﬀect with real added value
for the practice and patients. With
only one shade, Omnichroma Flow
BULK allows for inﬁnitely variable
colour matching to all 16 classic VITA
tooth shades from A1 to D4. This not
only ensures that the right shade is
always in stock, but also makes the
restorative therapy workﬂow easier
and more eﬃcient.

Tokuyama Dental,
Japan
www.tokuyama-dental.eu
Hall 10.1, Booth A40

AUFGABE GELÖST – MIT GC! SOLVED WITH GC!
GC konzentriert sich auf Lösungen und verhilft Zahntechnikerinnen und Zahntechnikern
zu mehr Eﬃ zienz und vorhersagbaren Ergebnissen und damit zu mehr Erfolg. Bei der
Produktentwicklung achtet GC besonders auf
eine einfache Handhabung. Das verkürzt die
Prozesszeiten – ohne Kompromisse beim Endergebnis. Alle Produkte sind optimal aufeinander abgestimmt. Wenn man sie miteinander kombiniert, kommen sämtliche Vorteile
zum Tragen.
Die farb- und formkeramischen Lösungen
von GC bieten höchste Ästhetik für Vollkeramikrestaurationen – und das innerhalb einer
Mikroschicht. Initial IQ ONE SQIN erleichtert
die Herstellung hochästhetischer Front- und
Seitenzahnrestaurationen aus vollkeramischen
Werkstoﬀen wie Lithiumdisilikat oder Zirkonoxid und vermeidet arbeitsintensive Schichttechniken. Die Produktivität steigt – unabhängig davon, welche Technik das Labor bevorzugt. Das System besteht aus drei Komponenten: Lustre Pastes ONE, SQIN und Spectrum
Stains. Die 3D-Farbkeramik Lustre Pastes ONE
auf Feldspatbasis verleiht monolithischen Versorgungen Farbe, Tiefe und naturgetreue Transluzenz mit natürlichem Glanz. Die Fluoreszenz
monolithischer Restaurationen ist dann von
der Fluoreszenz natürlicher Zähne nicht zu
unterscheiden.
Bei bukkal reduzierten monolithischen
Restaurationen dient Lustre Pastes ONE als
Farb- und Connector-Brand vor dem Auftrag
der SQIN-Keramik in Mikroschichttechnik. Die
SQIN-Keramik lässt sich in einer dünnen Schicht
von etwa 0,1 bis 0,6 mm ganz leicht auf die gebrannte Lustre Pastes ONE-Oberﬂäche auftragen. Diese veredelte Feldspat-Keramikmischung
besitzt einzigartige Applikations- und Modelliereigenschaften, die eine individuelle Oberﬂächentexturierung im feuchten Zustand ermöglichen. Darüber hinaus ist sie selbstglasierend, wodurch ein separater Glanz- und Glasurbrand überﬂüssig wird.
Die Spectrum Stains runden das Konzept
ab und bieten unbegrenzte Möglichkeiten zur
individuellen Charakterisierung.

Alle Dentalfachleute sind eingeladen, die
Vorteile der Arbeitsabläufe und Lösungen von
GC live stattﬁndenden Workshops und LaborDemos direkt zu erleben – auf der IDS am
Messestand. Dort werden auch täglich international renommierte Zahnärzte und Zahntechniker in der Speakers’ Corner zu aktuellen Themen referieren.
By focusing on solutions rather than problems, GC helps dentists achieve success with
greater eﬃciency and predictability. By designing easy-to-use products, we can help you
reduce your working time without compromising on the result. All of our products are optimally coordinated. When used in combination,
you take full advantage of our solution workﬂows.
Our colour-and-form ceramic solutions provide maximum aesthetics to your all-ceramic
restorations, within one micro-layer.
Initial IQ ONE SQIN facilitates the design
of highly aesthetic posterior restorations made

from a single material such as lithium disilicate or zirconia, avoiding cumbersome and
time-consuming layering techniques. Productivity is increased, regardless of which technique the dental technician prefers to use. The
system consists of three elements: Lustre
Pastes ONE, SQIN and Spectrum Stains. For full
monolithics, the Lustre Pastes ONE, feldspar-based 3D-paint-on ceramic will add colour, depth and lifelike translucency with a genuinely natural glaze. Their inherent ﬂuorescence brings the ﬂuorescence of your monolithic restorations to a level that is not distinguishable from natural teeth’s.
For buccally reduced monolithics, these
Lustre Pastes ONE also serve as the connection
ﬁring before application of SQIN ceramics in
the micro-layering technique. SQIN ceramic is
easily applied in a thin layer of about 0.1 to
0.6 mm over the ﬁred Lustre Pastes ONE surface. This reﬁned mixture of feldspar-based
glasses has unique application and modelling
properties that enable individual surface tex-

40th International Dental Show 2023 • 16. März 16 March

turing in the wet stage. On top of that, it has
self-glazing properties, omitting a separate glaze
ﬁring.
The Spectrum Stains complete the concept
and equip you with inﬁnite characterisation
possibilities.
All dental professionals are invited to experience the beneﬁts of all our workﬂows and
solutions at the booth during hands-on courses
and lab demos. Additional booth
experience will include interInfos zum Unternehmen
Company Information
nationally renowned dentists
and technicians daily presenting on current topics of interest on the booth at the speakers’ corner.

GC Europe, Belgium
www.gc.dental/europe
Hall 11.2
Booth N010/O039

[21] =>

NEW

Your NEW dentine restoration system

All Biodentine’s science
with the e
erience
you expect

Visit us Hall 11.1
Biodentine XP Medical Device Class III awaiting CE marking.
The information contained in this support is intended for the international public of health professionals
attending IDS 2023 and is not specifically intended for health professionals practicing in Germany, who
are therefore not subject to the obligation of compliance to the German law relating to the advertising
of medical devices.

[22] =>

industry

NAVIDENT EVO: ERWEITERUNG DES DIGITALEN WORKFLOWS ERMÖGLICHT GEFÜHRTE EINGRIFFE AM SELBEN TAG
NAVIDENT EVO: EXTENSION OF DIGITAL WORKFLOW ALLOWS FOR SAME-DAY GUIDED SURGERY
Sind Sie ständig auf der Suche
nach Möglichkeiten, Ihre Praxis von
anderen abzuheben und zu diﬀerenzieren? Wir kennen die Herausforderungen, denen Sie sich stellen müssen, wenn Sie ein Höchstmaß an
Leistung und Ergebnissen anstreben – organisatorisch, funktionell
und ästhetisch.
Denken Sie an einen Workﬂow
für Diagnostik, Implantatplanung
und dynamisch navigierte Implantatbehandlungen. Mit der dreidimensionalen Steuerung der Implantatbettaufbereitung und der dynamisch
überwachten Implantatinsertion können Behandlerinnen und Behandler
schnelle und hochpräzise Eingriﬀe erzielen. Vom CBCT-Scan bis zum Beginn des Eingriﬀs vergehen nur wenige Minuten. Navident bietet eine
verzögerungsfreie Echtzeitführung
des Bohrers und der Implantatposition in Bezug auf die Anatomie des
Patienten auf der Grundlage des CBCTScans.

Navident EVO liefert
konsistente Ergebnisse
in verschiedenen medizinischen Fachbereichen
Implantologie: Mit Navident
EVO können Sie hochpräzise Implantatbehandlungen mit Leichtigkeit und Vertrauen durchführen. Es

hilft, wichtige anatomische Strukturen genau zu erkennen.
Endodontie: Navident EVO hilft
bei der genauen Lokalisierung von
Wurzelkanälen und anderen empﬁndlichen anatomischen Strukturen.
Knochenchirurgie: Die hochpräzise Navigation Ihres Piezotoms
oder Ihrer Säge durch Navident EVO
gewährleistet eine genaue Beurteilung und konsistente Ergebnisse bei
knochenchirurgischen Eingriﬀen.
Das neue Navident EVO-System
ist nicht nur mit der Kameratechnologie der nächsten Generation ausgestattet, sondern bietet auch ein
schlankes Design, eine ergonomische
Installation und die intuitive Benutzeroberﬂäche bis hin zur Interaktion
mit dem Touchscreen. Es wurde ent-

wickelt, um einen angenehmen, reibungslosen Arbeitsablauf für Behandlerinnen und Behandler in jeder Phase ihrer Karriere zu ermöglichen.
Navident kann sowohl auf einem
Wagen, an der Wand als auch an
der Decke oder am Behandlunsstuhl
montiert werden. Navident EVO ist
jetzt zu einem speziellen Einführungspreis erhältlich und wird auf der IDS
exklusiv ausgestellt.
Are you constantly looking for
ways to elevate and diﬀerentiate your
practice from others? We know the
challenges you face when you are
aiming for the highest levels of
performance and results―organisational, functional, and aesthetic.

Think about a workﬂow for diagnostics, implant planning and dynamically navigated implant treatments.
Clinicians can achieve high precision,
shorter interventions with three-dimensional control of their implant site preparation and dynamically monitored
implant insertion. The procedure only takes minutes
from CBCT scanning to
the start of the surgery.
Navident provides real-time,
lag-free guidance of the drill
and implant position in relation to patient anatomy based
on the CBCT scan.

Navident EVO
delivers consistent results across
various medical
specialties
Implantology: With Navident
EVO, you can perform high-precision
implant treatments with ease and
conﬁdence. It helps to accurately detect important anatomical structures.
Endodontics: Navident EVO
helps to locate root canals and other
delicate anatomical structures accurately.
Bone surgery: The high-precision navigation of your piezotome or
saw provided by Navident EVO ensures accurate assessment and con-

sistent outcomes in bone surgery procedures.
In addition to being equipped
with a next-generation camera technology including robotic tag tracking,
the new Navident EVO system provides everything from sleek design
to ergonomic installation, intuitive user interface to touch
screen interaction, and is created to provide a pleasant,
smooth workﬂow for clinicians at
every stage of their career.
Available conﬁgurations for Navident are either cart-based or wall-,
ceiling-, or chair-mounted. Navident
EVO is now available at a special introductory price and is currently being showcased at IDS.

ClaroNav, Canada
www.navident.claronav.com
Hall 10.2, Booth O053

CERAMOTION ONE TOUCH VERLEIHT KERAMISCHEN MATERIALIEN DEN LETZTEN SCHLIFF
CERAMOTION ONE TOUCH ADDS THE FINISHING TOUCH TO CERAMICS
Zahnfarbe, der Helligkeitswert sowie
die Tiefenwirkung der Keramik optimiert werden. Die Fluoreszenz der
Pasten wurde der von echten Zähnen angepasst, um auch vollkeramischen Arbeiten ein natürliches Erscheinungsbild zu verleihen.

Mit ceraMotion
One Touch die dritte
Dimension erreichen

CeraMotion One Touch sind speziell entwickelte 2D- und 3D-Pasten
für die ästhetische Finalisierung
und Charakterisierung von vollkeramischen monolithischen Restaurationen aus Lithiumdisilikat und Zirkonoxid. Mit ceraMotion One Touch
gelingt das individuelle Gestalten
und Glasieren einfach und schnell –
und das in nur einem Brand.
Die farblich abgestimmten
ceraMotion One Touch-Pasten sind
mit Zirkonoxid oder Lithiumdisilikat
kompatibel und werden in einem
speziellen Hightech-Verfahren hergestellt. Die Partikelgröße der Pasten ist dabei an die Anforderungen
der Maltechnik (2D) angepasst, außerdem kann eine individuelle Mor-

phologie im Schneide- bzw. Kauﬂächenbereich (3D) gestaltet werden.
Die Zusammensetzung ermöglicht
eine homogene Benetzung der Oberﬂäche von vollkeramischen Objekten. Durch den thixotropen Eﬀekt erhält man einen perfekten Oberﬂächenverbund sowie die Möglichkeit
einer minimalen Schichtung. Alle
ceraMotion One Touch-Pasten sind
transluzent und erhalten so den lichtdynamischen Eﬀekt des Gerüstmaterials.

Die 2D-Pasten bringen
Licht in den Zahn
Durch das Zusammenspiel der
geringen Partikelgröße mit der Transluzenz der 2D-Pasten können die

Durch die Verbindung etwas größerer Keramikpartikel mit einer thixotropen Paste kann eine Formgestaltung im Schneide- bzw. Kauﬂächenbereich sowie das präzise Anbringen von Kontaktpunkten erfolgen.
Die Brennstabilität der 3D-Pasten gewährleistet den Erhalt der gewünschten Morphologie. Durch die Transluzenz und Opaleszenz der gebrauchsfertigen 3D-Schneiden wird eine lebendige Tiefenwirkung erzeugt.
CeraMotion One Touch are specially developed 2D and 3D pastes for
an aesthetic ﬁnishing and characterisation of all-ceramic monolithic restorations made of lithium disilicate
and zirconium oxide. CeraMotion One
Touch helps you achieve individual
characterisation and glazing quickly
and easily in just one ﬁring cycle.
The ceraMotion One Touch pastes
are colour-coordinated, compatible with
zirconium oxide or lithium disilicate
and are manufactured using a special
high-tech process. The particle size of
the pastes has been adapted to suit
the requirements for the staining
technique (2D) and to oﬀer the possi-

bility of creating an individual morphology in the incisal area and in the
occlusal surface area (3D). The consistency allows a homogenous wetting of all-ceramic object surfaces.
The thixotropic eﬀect produces perfect surface integrity and allows for
minimal layering. All ceraMotion One
Touch pastes are translucent, thereby
retaining the light dynamic eﬀect of
the framework material.

The 2D pastes create
light in the tooth
The small particle size together
with the translucency of the 2D
pastes help optimise the colour of
the tooth, the brightness value and
the in-depth eﬀect of the ceramic
material. The ﬂuorescence of the
pastes has been adapted to that of
natural teeth, providing a natural
appearance to all-ceramic restorations.

Attaining a third
dimension with
ceraMotion One
Touch
By joining slightly
larger ceramic particles with a thixotropic paste, it is
possible to shape the
incisal area and the
occlusal surface area
and to add contact

40th International Dental Show 2023 • 16. März 16 March

points precisely. The ﬁring stability of
the 3D pastes guarantees that the desired morphology is maintained. The
translucency and the opalescence of
the ready-made 3D incisal masses
create an in-depth eﬀect which appears authentic.

Dentaurum, Germany
www.dentaurum.com
Hall 10.1
Booth D010/E019

[23] =>

TODAY LIVE
Thu - March 16
09:30 - 10:30

Vestibular veneering of a central incisor
and individual characterisation of a monolithic zirconia crown on the adjacent tooth

11:00 - 12:00
Aesthetic aspects by using composites with
2 different viscosities for the fabrication of
anterior restorations with natural appearance

12:30 - 13:30

Characterisation of posterior zirconia
crowns! How to manage the viscosity and
chroma of the stains to obtain naturallooking colouring effects

14:00 - 15:00

Lifelike monolithic restorations with 3Dstaining on different monolithic materials

15:30 - 16:30
Advanced composite resin technology
in direct and indirect application
17:00 - 18:00

Hall 11.3
Stand C010

www.shofu.de

Aesthetic aspects by using composites with
2 different viscosities for the fabrication of
anterior restorations with natural appearance

[24] =>

industry

CURASEPT – FIRST BECAUSE WE CARE CURASEPT—FIRST BECAUSE WE CARE
Curasept ist eine weltweit renommierte
Mundhygienemarke, deren Produktlinie mit
dem Anti-Discoloration-System (ADS) unter
Dentalfachleuten zu einem Kernprodukt geworden ist. Über das Unternehmen, das hinter dieser Innovation steht, sowie weitere
Produktlinien ist dagegen nur wenig bekannt.
Curasept wurde 2001 in Italien gegründet und
ist zu 100 Prozent ein italienisches Unternehmen. Forschung, Know-how, Beharrlichkeit, detaillierte Analysen und ein Augenmerk auf die Bedürfnisse der Verbraucherinnen und Verbraucher sind die Eckpfeiler
der Entwicklungsarbeit, welche die Forschungs- und Entwicklungsabteilung des Unternehmens nun schon seit mehr als 20 Jahren leistet. Ihr Ziel ist es, hochinnovative

Produkte zu entwickeln, die echte Neuerungen darstellen.

Curasept ADS –
maßgeschneiderte Lösungen
für jeden klinischen Bedarf
Chlorhexidin gilt noch immer als das wirksamste orale Antiseptikum und hat sich inzwischen sogar zum Goldstandard der Branche
entwickelt. Zu den sicherlich bekanntesten Nebenwirkungen von Chlorhexidin zählen jedoch
bräunliche Ablagerungen, welche die Compliance-Rate beeinträchtigen können.
Das patentierte ADS-System ist in der Lage,
die beiden wichtigsten Reaktionen, die zu Ablagerungen führen, zu beeinﬂussen: die Maillard-Reaktion und die Proteindenaturierung.

Die Tatsache, dass die Curasept ADS-Linie keinen Alkohol und kein Natriumlaurylsulfat ent-

Bone Cutters with hard ZrN (zircon-nitride) coating
Bone Cutter C162AAC
Conical bone cutter used for preparing bone and tooth structure. The
Lindemann blades, newly optimised with ZrN (zircon-nitride) hard coating,
guarantee quiet instrument running at the highest cutting capacity and
perfect cutting performance for enhanced cutting sensation and maximum
cutting control. The hard ZrN (zircon-nitride) coating ensures the cutter
meets the high demands placed on a high-quality surface during surgical
bone preparation. Application: Separating teeth and tooth roots, exposing
and removing impacted wisdom teeth, removal of root remnants.

Bone Cutter C162SAC
Bone cutter for gentle trimming of bone and tooth structure. The special
S-cut for optimum cutting sharpness and perfect blade action for an even
better cutting sensation and maximum cutting control. The hard ZrN
(zircon-nitride) coating ensures the cutter meets the high demands placed
on a high-quality surface during surgical bone preparation. Application:
Exposing and removing retained teeth, removing root remains, preparation
of bone structure and bone lids, apicectomies, cutting teeth and tooth roots.

Bone cutter C254AAC
Bone cutter used for minimally invasive preparation of bone and tooth
structure. The special A-cut blades guarantee very quiet instrument running
at the highest cutting capacity and maximum conservation of bone structure
to be prepared. The long, slimline instrument neck provides excellent
visibility during preparation. The hard ZrN (zircon-nitride) coating ensures
the cutter meets the high demands placed on a high-quality surface during
surgical bone preparation. Application: Exposing and removing impacted
wisdom teeth, apicectomies, preparation of bone structure and bone lids,
separating teeth and tooth roots.

Surgery Diamonds
Osteotome GSD1T
For removing and smoothing bone as well as cutting tooth roots. The
special shape together with the multilayer diamond coating ensure a gentle
ﬁt to the bone structure and thus less heat development. In addition, the
high-performance TiN coating ensures optimum removal of bone and tooth
substance as well as a long service life. Grit size: coarse = 151 μm.

Surgical diamond G254T
Surgical diamond instrument for removing and smoothing bone surfaces as
well as for separating teeth and effectively cutting tooth substance in dental
osteotomy. The multilayer diamond coating ensures gentle treatment of the
bone structure and therefore also less heat development. In addition, the
high-performance TiN coating ensures optimum removal of bone and tooth
substance as well as a long service life of the diamond instruments.
Grit size: standard = 126 μm.

hält, trägt zur Vermeidung des Risikos von Nebenwirkungen bei, das mit einer längerfristigen Verwendung von alkoholhaltigen Mundspülungen verbunden ist, wodurch die Compliance-Raten steigen.
Die Wirksamkeit von Curasept ADS wurde
durch zahlreiche In-vitro- und In-vivo-Studien
bestätigt, darunter eine systematische Übersichtsarbeit und Metaanalyse1 zur Wirksamkeit von Chlorhexidin-Mundspülungen mit und
ohne ADS, die 2018 auf dem EuroPerio9Kongress in Amsterdam in den Niederlanden
vorgestellt wurden.
Curasept arbeitet bzereits an weiteren großen Innovationen in der Produktpalette.
Curasept is a well-known oral care brand that
was founded in 2001 in Italy. High-quality science, perseverance, detailed analysis and attention to the needs of its customers have been the
cornerstones of its development and achievements over the past 20 years. The development
of the Curasept ADS line, which has achieved a
market share of 65% in Italy, is a telling example
of this.

Curasept ADS—tailored solutions
for any clinical need
Chlorhexidine is still considered to be the
most eﬀective oral antiseptic. It is even deﬁned
as the gold standard in this ﬁeld. However, the
consequent development of dental discoloration
is a well-established adverse side eﬀect of chlorhexidine and can lead to reduced patient compliance.
The patented ADS system is able to interfere with the two main reactions that are responsible for staining: the Maillard reaction and
the protein denaturation process. Moreover,
the Curasept ADS line, thanks to the absence of
alcohol and sodium lauryl sulphate, helps prevent the risk of developing side eﬀects related
to the prolonged use of alcohol-based mouthwashes, increasing patient compliance.
The eﬃcacy of Curasept ADS has been
conﬁrmed by numerous in vitro and in vivo
studies, including a systematic review and
meta-analysis1 on the eﬃcacy of chlorhexidine
mouthwash with and without ADS, presented
at the EuroPerio9 congress held in Amsterdam
in the Netherlands in 2018.
Curasept is already working on further major innovations in the product range.
Reference
1 Van Swaaij BW, Van der Weijden GA, Bakker EW, Slot
DE. The eﬃcacy of chlorhexidine mouthwash, with and
without an anti-discoloration system (ADS), on the parameters plaque, gingivitis and tooth surface discoloration.
A systematic review and meta-analysis. 2018 [cited 13
Jan 2022]. 1 p. Available from: https://www.dentalinfo.nl/
wp-content/uploads/2018/09/Systematic-review-chloorhexidine-met-en-zonder-ADS-B.-van-Swaaij-Curasept.pdf.

Surgical diamond D254T

G254T

Surgical diamond instrument for atraumatically separating teeth and
effectively cutting tooth substance in root tip resection. The multilayer
diamond coating ensures gentle treatment of the tooth substance and
therefore also less heat development. In addition, the high-performance
TiN coating ensures optimum removal of tooth substance as well as a long
service life of the diamond instruments. Not recommended for chipping
bone. Grit size: coarse = 151 μm.

Hall 11.3, Booth A060 - B069

EDENTA AG, Switzerland
International Dental
Show
2023 • 16. März 16 March
EDENTA
Etablissement,
Liechtenstein
www.edenta.com

Curasept, Italy
www.curaseptworldwide.com
Hall 5.2
Booth C070/D071

[25] =>

An easy way to make
a great impression
LET‘S MEET AT IDS!

[1] Ender A et al. Int J Comput Dent 2019: 22: 11-19, additional data on file.

14 – 18 MARCH 2023
HALL 11.3
BOOTH A20/A10

®

VivaScan

– Compact and intuitive solution for
your entry into intraoral scanning
– High-accuracy 3D scanning for
high-precision digital impressions [1]
– Intuitive easy-to-use software and
lightweight ergonomic design for a
comfortable scanning experience

ivoclar.com

Making People Smile

[26] =>

Diamondexperts
since 1996

industry

DIE SAGEMAX-COMMUNITY IN KÖLN
THE SAGEMAX COMMUNITY IN COLOGNE

Sagemax community.
Scan the code.

Halle 11.2
Stand L008

Vielfalt für
Praxis und Labor
über 1.500 verschiedene
Diamantschleifinstrumente
in 60 Grundformen
bis zu 6 Körnungen
und 14 Durchmessern
Qualität made in Germany
Unsere Unimatrixdiamantierung garantiert
exzellenten Rundlauf, ein perfektes Schliffbild
und lange Lebensdauer.

Besuchen Sie unseren
Onlineshop auf www.nti.de
NTI-Kahla GmbH • Rotary Dental Instruments
Im Camisch 3 • D-07768 Kahla/Germany
Tel. 036424-573-0
E-mail: verkauf@nti.de • www.nti.de

Sagemax hat 2022 die SagemaxCommunity ins Leben gerufen. In
der Sagemax-Community können
Zahntechnikerinnen und Zahntechniker sowie Zahnärztinnen
und Zahnärzte aus der ganzen
Welt ihre Sagemax Patientenfälle
präsentieren.
Ziel der Sagemax-Community
ist es, den internationalen Austausch unter Zahntechnikerinnen
und Zahntechnikern sowie Zahnärztinnen und Zahnärzten zu
fördern. Die Community soll sich
gegenseitig mit Tipps und Tricks
und der Erklärung von Prozessabläufen unterstützen. Sagemax
gibt den Teilnehmenden damit
eine Bühne, den Arbeitsablauf
hinter einem schönen Lächeln zu
zeigen.

Highlight auf der IDS
Sagemax bringt die Community
nach Köln! Erleben Sie Live-Vorträge am Sagemax Stand! Werden
Sie Teil der Community! Erfahren
Sie mehr unter www.sagemax.com/
IDS2023.

Sagemax launched the Sagemax
community in 2022. In the Sagemax
community, dental technicians and
dentists from all over the world can
share their Sagemax patient cases.
The aim of the Sagemax community platform is to promote exchange
of knowledge and experience among
dental technicians and dentists
across countries and disciplines.
Community members are here to support each other with tips and tricks
and to explain procedures and workﬂows. Sagemax provides participants
a stage to showcase the workﬂow behind the beautiful smiles they create.

Highlight at IDS
Sagemax brings the community
to Cologne! Experience live presentations at the Sagemax booth!
Join the community! Learn more at
www.sagemax.com/IDS2023.
Sagemax, USA
www.sagemax.com
Hall 4.1
Booth A091

ÜBERTRAGUNGSINSTRUMENTE IM
HANDUMDREHEN AUFBEREITEN
Sicher, zuverlässig und zudem
zeitsparend ist die manuelle Instrumentenaufbereitung mit den hochwirksamen Systemkomponenten der
WL-Serie von ALPRO MEDICAL.
Zum Vorspülen dient die WaterJet-Pistole mit integriertem Wasserdruckbegrenzer vor der weiteren
Aufbereitung von Außen- und Innenﬂächen zahnärztlicher Übertragungsinstrumente und des allgemeinen Instrumentariums. Die
Spülvorrichtung ist speziell für die
Anwendung im Aufbereitungsraum
konzipiert und kann an die vorhandene Trinkwasserleitung angeschlossen werden. Die gebrauchsfertige Reinigungslösung WL-clean
befreit die Außen- und Innenﬂächen
der zahnmedizinischen Hohlrauminstrumente wie Turbinen, Handund Winkelstücke sowie innengekühlte Instrumente kraftvoll von
Protein- und Schmutzanhaftungen.
Dazu einfach die instrumentenspeziﬁschen und vom Instrumentenhersteller freigegebenen Adapter
von ALPRO MEDICAL auf die Druckﬂasche stecken und die Innenreinigung am Instrument mit drei Spülstößen durchführen. Nach einer
Einwirkzeit von nur einer Minute

schließt sich nahtlos die Desinfektion mit der Druckspüllösung WL-cid
an, die sowohl bakterizid, mykobakterizid, fungizid als auch voll viruzid
wirkt. Die sich anschließende notwendige, reinigungsunterstützende
Trocknung erfolgt wahlweise mit
der Druckluftpistole WL-Blow oder
dem medizinisch reinen Trocknungsspray WL-dry. Supereinfach, supersauber, supersicher – das ist die
WL-Serie von ALPRO MEDICAL.

ALPRO MEDICAL,
Germany
www.alpro-medical.de
Hall 11.2
Booth N008/O009

[27] =>

industry

DIE GESTALTUNG DER ZUKUNFT ÄSTHETISCHER UND FUNKTIONELLER ZAHNMEDIZIN
SHAPING THE FUTURE OF AESTHETIC AND FUNCTIONAL DENTISTRY
Die dentale Denkfabrik edelweiss
dentistry ist dafür bekannt, das einzige biomechanische Direkt-VeneerSystem ent wickelt zu haben, welches die Nachteile organischer Füllstoﬀe, die üblicherweise für Kompositverblendungen verwendet werden, überwunden hat. Durch ein
einzigartiges Laser- Sinter-Konzept
hat diese Technologie die natürlichen
Deﬁzite herkömmlicher Kompositmaterialien drastisch reduziert und
dadurch die Ästhetik und Funktion
verbessert.
Die Produktpalette umfasst ultradünne Schmelzschalen für den
Frontzahn- und Okklusalbereich, das
edelweiss POST & CORE Wurzelkanalsystem und das edelweiss
PEDIATRIC CROWN System. Die
neueste Ergänzung der Produktpalette sind die edelweiss CAD/CAM
BLOCKs (T- und C-BLOCK) und die
i-BLOCKs (Implantatblock), bestehend
aus dem weltweit ersten HybridglasMaterial mit Tri-Network-Struktur,
das reines Glas, Aluminiumoxid und
Resin-Technologie in einem Block
vereint, um so außerordentliche
Ästhetik, Festigkeit und Resilienz zu
garantieren.
Noch nie war es möglich, die natürliche Form und die jugendliche
Leuchtkraft eines Zahns in nur einer
Sitzung so einfach und perfekt zu gestalten. Das vielseitige Einsatzgebiet

sowie das zeit- und kostensparende
Verfahren machen das edelweiss
DIRECT SYSTEM zu einer sicheren
Investition in die Zukunft, und dies
im besten Interesse des Patienten.
Die Philosophie von edelweiss
dentistry ist simpel: Zahnbehandlungen für Patienten und Zahnärzte gleichermaßen einfach und erschwinglich zu gestalten. Ein weiterer Schwerpunkt liegt auf den ethischen Aspekten moderner Behandlungen, die
durch die Einhaltung der Prinzipien
von Biokompatibilität und Bioästhetik erreicht werden. Dies ermöglicht
minimalinvasive Behandlungen, da
die Restauration unter Erhaltung
der gesunden Zahnsubstanz durchgeführt wird. Funktion und Ästhetik
werden mit einem der Zahnsubstanz
sehr ähnlichen Hybridglas-Material
rekonstruiert – nach dem Konzept
der adhäsiven Additivtechnik.
Damit ist das edelweiss DIRECT
SYSTEM auf dem neuesten Stand
der modernen und minimalinvasiven Ästhetischen Zahnmedizin. Überzeugen Sie sich selbst und testen
Sie unsere Produkte live an einer
Hands-on-Station am edelweiss
Stand.
The edelweiss dentistry dental
think tank is known for pioneering the
only biomechanical direct veneering
system that overcomes the disadvan-

From left: VENEER and OCCLUSIONVD shells, CAD/CAM BLOCKs, POST & CORE system and PEDIATRIC CROWNs.

tages of the organic ﬁllers commonly used in composite veneers.
Employing a unique laser sintering
concept, this technology has dramatically reduced the natural shortfalls of conventional composites,
thereby enhancing aesthetics and
function.
The product range includes ultrathin anterior and occlusal enamel
shells, the edelweiss POST & CORE
system for post-endodontic needs
and edelweiss PEDIATRIC CROWNs.
The latest additions to the product
range are edelweiss CAD/CAM
BLOCK (T-BLOCK, C-BLOCK and
i-BLOCK—for implant restorations),
consisting of the ﬁrst hybrid glass
material in the world with a trinetwork structure, combining pure
glass, aluminium oxide and resin
technology in one block. This en-

sures extraordinary aesthetics, strength
and resilience.
Never before has it been possible
to create the natural shape and youthful luminance of a tooth so easily and
perfectly in only one appointment. Its
versatile area of application, in combination with the time- and cost-saving procedure involved, makes the
edelweiss DIRECT SYSTEM a sound
investment in the future with the best
interests of the patient at heart.
The philosophy of edelweiss
dentistry is simple: making dental
treatments easy and aﬀordable for
patients and dentists alike while
following ethical aspects of modern
treatment achieved by respecting the
principles of biocompatibility and
bio-aesthetics. This makes minimally
invasive treatment possible. Restorations are carried out while consider-

ing and preserving the healthy tooth
structure. Function and aesthetics
are reconstructed—with a highly ﬁlled
hybrid glass material very similar to
the tooth substance—using an adhesive additive technique.
This makes the edelweiss systems state-of-the-art for modern and
minimally invasive aesthetic dentistry. Convince yourself and try our
products at a live hands-on station at
the edelweiss booth.

edelweiss dentistry
products, Austria
www.edelweissdentistry.com
Hall 11.3
Booth D040/E041

40th International Dental Show 2023 • 14. März 14 March

[28] =>

industry

ALL-IN-ONE-SOFTWAREPLATTFORM PLANMECA ROMEXIS BESCHLEUNIGT ARBEITSABLÄUFE
PLANMECA ROMEXIS ALL-IN-ONE SOFTWARE PLATFORM MAKES YOUR WORKFLOW
Planmeca Romexis ist die leistungsstärkste Softwareplattform für
die Zahnheilkunde, die eine breite
Palette an Werkzeugen für die zahnmedizinische Bildgebung, Diagnose
und Behandlungsplanung für alle
Indikationen und Fachgebiete bietet. Dadurch, dass alle klinischen
Aufnahmen in einer einzigen, benutzerfreundlichen Software vorhanden sind, ermöglicht Romexis
reibungslose Arbeitsabläufe.

Bedürfnisse jeder Praxis anpassen
lässt. Die Praxis kann klein anfangen und neue Funktionen später hinzufügen – ﬂexibel und risikofrei mit
einfachen Lizenzaktualisierungen.
Neue Funktionen und Werkzeuge für
verschiedene Indikationen werden
durch dedizierte Softwaremodule eingeführt, die eine Erweiterung von 2Dauf 3D-Bildgebung und CAD/CAM
sowie vollständige Implantat-Workﬂows von der Implantatplanung bis

beit mit digitalen Abdrücken einfacher und schneller als je zuvor. Das
Modul optimiert den Workﬂow zum
Scannen und Senden digitaler Abdrücke und bietet neuen Benutzerinnen und Benutzern von Intraoralscannern einen reibungslosen Einstieg in
die Welt der CAD/CAM-Zahnmedizin.
Ein zweites neues Modul, Planmeca
Romexis Ortho Simulator, bietet
schnelle und intuitive Werkzeuge für
Zahnsimulationen. Der auf künstlicher

Planmeca Romexis ist eine ﬂexible und leistungsstarke Softwareplattform, die eine All-in-one-Lösung
für alle Fachrichtungen und Zahnarztpraxen jeder Größe bietet. Die
Software unterstützt sowohl 2Dund 3D-Bildgebung als auch CAD/
CAM und ermöglicht es Anwendern,
alle Vorteile der Digitalen Zahnmedizin zu nutzen.
Mit Romexis werden alle klinischen Aufnahmen in einer Datenbank gespeichert, sodass sie gleich
dem zahnmedizinischen Fachpersonal für Diagnose und Behandlungsplanung zur Verfügung stehen. Die
Software verfügt auch über einen
cloudbasierten Übertragungsdienst,
mit dem Patientendaten mit externen Spezialisten und Dentallaboren
auf eine sichere Weise geteilt werden können.
Romexis ist eine modulare Softwareplattform, die sich leicht an die

hin zum Design und der Fertigung
der Bohrschablone ermöglichen.
In Romexis wurden die gängigsten Arbeitsabläufe optimiert, um sicherzustellen, dass alltägliche Aufgaben schnell und mit möglichst
wenig Klicks erledigt werden können.
Aufbauend auf jahrelangem Feedback führt die neueste Version von
Romexis zudem eine hochmoderne
Benutzeroberﬂäche ein, dessen Design und Benutzerfreundlichkeit mit
dem Golden A’ Design Award ausgezeichnet wurde.
Planmeca hat eine starke Erfolgsbilanz bei der kontinuierlichen
Erweiterung von Romexis um neue
Funktionen und Verbesserungen, wodurch Anwenderinnen und Anwender mit den neuesten Innovationen
der Digitalen Zahnheilkunde arbeiten
können. Beispielsweise macht das
kürzlich eingeführte Softwaremodul
Planmeca Romexis CAD/CAM die Ar-

Intelligenz (KI) basierende Algorithmus erstellt Simulationsvorschläge
für kieferorthopädische Fälle, die bei
der Patientenkommunikation unterstützen und das Potenzial von AlignerBehandlungen aufzeigen.
Im 3D-Bildgebungsmodul steht
zudem eine neue, KI-basierte Funktion, Romexis Smart, zur Verfügung.
Sie ermöglicht die automatische Segmentierung und Erkennung von Zahnanatomien, Nerven, Atemwegen und
Nebenhöhlen. Mithilfe künstlicher
Intelligenz werden auch DVT-Bilder
und Intraoralscans automatisch eingezeichnet. Insgesamt ermöglicht die
neue Funktion eine einfachere und
schnellere Nutzung der Software und
bietet ein hervorragendes Werkzeug
für die Patientenaufklärung.
Entdecken Sie Planmeca Romexis
und die digitale Komplettlösung von
Planmeca am Stand des Unternehmens.

Planmeca Romexis is the most powerful software platform for dentistry,
oﬀering an extensive range of tools
for dental imaging, diagnosis and
treatment planning for all indications
and dental specialties. The software
ensures seamless daily workﬂows at
a dental practice by making all clinical image data available in a single,
easy-to-use system.
Planmeca Romexis is a ﬂexible
and powerful software platform, providing an all-in-one solution for all
specialities and clinics of all sizes.
The software supports the most versatile range of 2D and 3D imaging as
well as CAD/CAM and enables users
to enjoy all the beneﬁts of digital dentistry—with just one program.
With Romexis, all clinical images
are stored in one database, allowing
patient data to be easily shared with
other dental staﬀ members for diagnosis and treatment planning. Additionally, the software includes a cloudbased transfer service, through which
patient data can be securely shared
with external specialists and laboratories.
Romexis is a modular software
platform that adapts to the needs of
any dental practice. It grows with the
clinic, allowing the clinic to start
small and add new capabilities as the
business expands—ﬂexibly and riskfree with easy licence updates. New
features and tools for various indications are introduced by dedicated
software modules, which allow evolution from 2D to 3D imaging and from
CAD/CAM to full implant workﬂows,
from implant planning to guide design and manufacture.
In Romexis, the most common
workﬂows have been optimised to ensure everyday tasks can be done
quickly with minimal clicks. Building
on years of feedback, the newest version of Romexis introduces a cuttingedge interface, which has also received the Golden A’ Design Award
for its design and usability.

Planmeca has a strong and proven
record of steadily adding new features and improvements to Romexis,
allowing users to always work with
the latest innovations in digital dentistry. For example, the recently released Planmeca Romexis CAD/CAM
module makes working with digital
impressions easier and faster than
ever before. It streamlines the scanand-send workﬂow for capturing, analysing and exporting digital impressions and oﬀers new intra-oral scanner
users a smooth entry into the world
of CAD/CAM dentistry.
Another new module, Planmeca
Romexis Ortho Simulator, provides
fast and intuitive simulation tools for
revealing the true potential of a patient’s smile in a matter of minutes
right after intra-oral scanning. The artiﬁcial intelligence (AI) algorithm of
Ortho Simulator creates simulation
proposals for orthodontic cases and
makes it easy to discuss treatment
possibilities and showcase the potential of clear aligner treatments with
patients.
Furthermore, the 3D imaging module now has a new AI-based feature,
Romexis Smart. It allows the automatic segmentation and recognition
of anatomy, such as teeth, nerves,
jaws, airways and sinuses. With the
help of AI, CBCT images and intra-oral
scans are also automatically mapped.
All in all, Romexis Smart enables easier and faster use of the software and
excellent visualisation of the case for
patient education.
Discover Planmeca Romexis and
Planmeca’s complete digital solution
at the company’s booth.

sorption at the lowest level possible
in order to avoid material failure.

ponents to assure normal vitality. The
material has suﬃcient opacity to
mask darkness and yet enough translucency to oﬀer a vibrant, natural appearance.

Planmeca, Finland
www.planmeca.com
Hall 1.2
Booth A020/C029

DMP DENTAL: BRIGHT TEMPORARY C&B
DMP has more than 35 years of experience in dental material manufacturing, and the company supplies the
global dental market, achieving top
quality and reliability through the integrity, passion and commitment ingrained in DMP’s culture. DMP is
best known for BONASIL—its broad
range of silicone impression materials—and for its BRIGHT line of aesthetic ﬁlling materials. DMP aims to
create bright smiles and to provide
the highest level of satisfaction by cooperating closely with its customers
and maintaining a high degree of
ﬂexibility in catering for individual
market needs.
DMP has expanded its BRIGHT
TEMPORARY C&B family with 10:1
and 4:1 delivery systems. BRIGHT
TEMPORARY C&B is a self-polymerising, mouldable composite for the fabrication of provisional crown and
bridge restorations. It oﬀers exceptional aesthetic results and has optimal mechanical and physical proper-

ties. Its simplicity of use makes it
the ideal product for provisional restorations.

Superior strength
The material is characterised by
its very high ﬂexural and compres-

sive strength, allowing the fabrication
of long-lasting provisional restorations. This is achieved by using organic monomers of the highest quality and glass ﬁller with ideal particle
size dispersion. Moreover, the advanced technology keeps the water

Exceptional aesthetics
The glass ﬁller in the formulation
contains a scientiﬁcally developed
blend of opaque and translucent com-

40th International Dental Show 2023 • 16. März 16 March

Simplicity and patient
comfort
BRIGHT TEMPORARY C&B is deﬁned by its simplicity of use. It has a
thin oxygen inhibition layer and can
be easily trimmed, ﬁnished and polished, thus saving time in daily practice. In addition, the composite contains the ideal ratio of active ingredients, keeping the heat generated
during polymerisation at nearly zero,
ensuring patient comfort and protecting the dental pulp.

DMP Dental, Greece
www.dmpdental.com
Hall 10.1
Booth B028/C029

[29] =>

DRUCKLUFT

|

ABSAUGUNG

|

BILDGEBUNG

|

ZAHNERHALTUNG

|

HYGIENE

Bis zu 75% weniger Energieverbrauch*
Nachhaltigkeit und Skalierbarkeit mit den Tyscor Saugsystemen

Monitoring und Fernwartung
durch VistaSoft Monitor
reduziert CO2-Emissionen.

Radialverdichter reduziert
Energieverbrauch
um bis zu 75 %.*

Wächst mit der Praxis mit: Von
zwei bis zwölf Behandler,
ohne Austausch der Maschine.

Nachhaltige Produkte von Dürr Dental.
Mit unseren Tyscor Saugsystemen gehen wir den nächsten Schritt in eine nachhaltige Zukunft.
Damit machen wir nicht nur unsere Produktionskette nachhaltiger, sondern auch Ihre Praxis.
Mehr unter www.duerrdental.com
*gemessen an der Tyscor VS 4 und einem vergleichbaren Seitenkanalverdichter durch das Fraunhofer Institut

[30] =>

industry

ANLEITUNG FÜR IHREN WECHSEL ZU SYNTHETISCHEN LÖSUNGEN
GUIDING YOUR SHIFT TOWARDS SYNTHETIC SOLUTIONS
Das Pharmaunternehmen Septodont hat sich
auf die Zahnmedizin spezialisiert und will alle
Zahnärztinnen und Zahnärzte bei ihrer täglichen Arbeit unterstützen. Wir bieten unseren Kundinnen und Kunden zahnmedizinische Qualitätsprodukte und Dienstleistungen
auf höchstem Niveau.
Deshalb haben wir vor Kurzem Biomedical
Tissue übernommen, eines der führenden Unternehmen im Bereich Tissue Engineering,
das Membranen für die Geweberegeneration
entwickelt und produziert.
Nun präsentiert Septodont die R.T.R.+
Membrane, eine einzigartige resorbierbare
synthetische Membran, die die Behandlung
nach einer Zahnextraktion optimiert. Studien
haben gezeigt, dass die Verwendung einer

Membran zusammen mit einem Knochenaufbaumaterial einen bis zu 30 Prozent höheren
Knochenvolumenzuwachs nach einer Zahnextraktion ermöglicht.1
Die R.T.R.+ Membrane ist eine patentierte
Technologie, die in jahrelanger Forschung entwickelt wurde. Als erste resorbierbare Membran besteht sie zu 100 Prozent aus pﬂanzlichen Polymeren und ist daher eﬀektiv und
einfach zu handhaben. Sie ist die perfekte Ergänzung zum Knochenersatzmaterial R.T.R.+
für ein erfolgreiches synthetisches Verfahren.
Mit einer Resorptionszeit von vier bis sechs
Monaten und einem Doppelschichtaufbau ist
R.T.R.+ innerhalb eines angemessenen Zeitrahmens für die Knochenregeneration hochwirksam. Die Membran ist äußerst belastbar.

R.T.R.+ Membrane ist mit jedem Knochenersatzmaterial kompatibel und in vier Größen erhältlich.
R .T.R.+ Membrane is compatible with all bone grafting material and is available in four sizes.

Im Fall einer Ruptur der Naht kann die Membrane an Ort und Stelle belassen werden, um
die Heilung des Gewebes zu fördern.
Anmerkung: Die R.T.R.+ Membrane, ein Medizinprodukt der
Klasse III, beﬁndet sich im Freigabeprozess für die CE-Kennzeichnung. Die in diesem Dokument enthaltenen Informationen richten sich an das internationale Fachpublikum aus
dem Gesundheitswesen, das an der IDS 2023 teilnimmt,
und sind nicht speziell für in Deutschland praktizierende
Mediziner bestimmt. Das internationale Fachpublikum unterliegt nicht der Verpﬂ ichtung zur Einhaltung der deutschen Gesetze über die Werbung für Medizinprodukte.

As a pharmaceutical company specialising in
dentistry, Septodont’s aim is to support every
dentist to succeed in his or her daily procedures. Our mission is to provide our customers
with dental products and services that are unsurpassed in meeting their expectations of
quality and performance. In pursuit of our mission, we recently acquired Biomedical Tissue, a
company at the forefront of tissue engineering
which designs and produces membranes for tissue regeneration.
Septodont is pleased to introduce R.T.R.+
Membrane, a unique resorbable synthetic membrane designed to improve post-extraction procedures. After a tooth extraction, using a membrane with the bone grafting material allows for
up to 30% more bone volume.1
Thanks to years of research leading to a
patented technology, R.T.R.+ Membrane is the
ﬁrst resorbable membrane composed of 100%
vegetal-based polymer, making it eﬀective and
easy to handle. It is the perfect complement to
the R.T.R.+ bone grafting material for a successful, synthetic procedure.

With a resorption time of four to six months
and a bilayer structure, R.T.R.+ Membrane is
highly eﬀective within an appropriate time frame
for bone regeneration. R.T.R.+ Membrane also has
great resistance to exposure. In case of suture
rupture, it can be left in place to guide the tissues to heal properly.
Visitors to IDS can try R.T.R.+ Membrane at
Septodont’s booth.
Note: R.T.R.+ Membrane, a Class III medical device, is awaiting CE marking. The information contained in this text is
intended for an international audience of healthcare professionals attending IDS 2023 and is not speciﬁcally intended
for healthcare professionals practising in Germany and is
therefore not subject to the obligation of compliance with the
German law relating to the advertising of medical devices.
Reference
1 Kim, Myoung-Hwan et al. Eﬀect of bone mineral with or
without collagen membrane in ridge dehiscence defects
following premolar extraction. In Vivo. 2008 Mar–Apr;
22(2):231–6. PMID: 18468408.

Septodont, France
www.septodont.com
Hall 11.1
Booth C010/D019

NEUE GENERATION VON NITI-ROTATIONSFEILEN AUS JAPAN
NEW-GENERATION NITI ROTARY FILES FROM JAPAN
JIZAI – NiTi-Feilen der neuen Generation
von MANI. Aus dem Japanischen übersetzt,
bedeuten der Name „Unbeschränktheit“. Das
JIZAI-System stellt die neueste Ergänzung der
MANI-Produktlinie für die Endodontie dar.
JIZAI basiert dabei auf drei grundlegenden Features:
1. Das glatte Design sorgt für optimales
Schneiden. Rundschliﬀfasen verhindern
eine Überinstrumentierung und ein übermäßiges Anschlagen an den Wurzelkanalwänden. Die außermittige Feilenachse ist
so konzipiert, dass sie einen größeren
Raum für die Entfernung von Ablagerungen während der Instrumentierung bietet.
2. Dank der Flexibilität wird die ursprüngliche Anatomie berücksichtigt. Die Wärmebehandlung, die jede JIZAI-Feile durchläuft, sorgt für ein deutlich geringeres
Risiko von Stufenbildung, Transportschäden und Perforationen.
3. Durch die verfahrensbasierte Sequenzierung können die Feilen selbst stark gekrümmte Kanäle mit Leichtigkeit formen.
Jede Feile ist vollständig wärmebehandelt,
hochﬂexibel und für reibungsloses und eﬃzientes Schneiden ausgelegt. Die Querschnittsform und die Wellenteilung tragen dazu bei,
eine Überinstrumentierung und Eindrehung
der Feilen zu vermeiden. Jede Feile kann vorgebogen werden und behält ihre Form entsprechend bei.
Die in Japan hergestellten Feilen sind in
Einzelpackungen mit je drei Feilen in ISOGröße oder als Teil eines Standardkits erhältlich, welches Feilen in den Größen #25.04,
#25.06 und #35.04 enthält, die für die Instrumentierung gerader und leicht gekrümmter
Kanäle konzipiert wurden.

40th International Dental Show 2023 • 16. März 16 March

JIZAI are the new-generation NiTi ﬁles from
MANI. The name can be translated from Japanese and means “being at will”. The JIZAI system is the newest addition to the MANI endodontic product line.
Three foundational features form the basis
of JIZAI:
1. The smooth design provide an optimal cutting experience. Radial lands help prevent
over instrumentation and excessive engagement on the root canal walls. The oﬀ-centre
ﬁle axis is uniquely designed to provide a
larger pocket space for debris removal during instrumentation.
2. The ﬁles are extremely ﬂexible to ﬁt the
individual anatomy of the tooth. The heat
treatment that each JIZAI undergoes results
in a signiﬁcantly lower risk of ledging, transportation and perforation.
3. Procedural-based sequencing allows the
ﬁles to shape even severely curved canals
with ease.
Each ﬁle is fully heat-treated, highly ﬂexible
and designed to cut smoothly and eﬃciently.
The crosssectional shape and ﬂute pitch help
prevent over instrumentation and ﬁle binding.
Each ﬁle can be pre-bent and will hold its shape.
The Japan-manufactured ﬁles are available
in individual ISO-sized packages of three ﬁles
or as part of a standard, which includes a sequence of 25./04, 25/.06, and 35/.04 ﬁles designed to instrument straight and slightly
curved canals.

MANI, Japan
www.mani.co.jp
Hall 10.1, Booth H019

[31] =>

edelweiss SYSTEMS

VENEER
OCCLUSIONVD
COMPOSITE
POST & CORE
PEDIATRIC CROWN
CAD/CAM BLOCK
edelweiss CAD/CAM BLOCK

T-BLOCK/C-BLOCK/i-BLOCK
T-BLOCK

i-BLOCK Implant

C-BLOCK

Translucent Enamel

Translucent Enamel & Chroma

Chroma

ONLY BLOCK ON THE
MARKET WITH A SOLID
GLASS PHASE

A0

A1

A2

Enamel
+A0 Dentin

Enamel
+A1 Dentin

A3

Enamel
+A2 Dentin

Enamel
+A3 Dentin

INDICATIONS

THIN VENEERS / VENEERS

ANTERIOR / POSTERIOR
CROWNS

OCCLUSAL
VENEERS

IMPLANT
CROWNS

INLAYS

ONLAYS

PARTIAL CROWNS

KEY FEATURES
Glass as a single phase for
aesthetics
Silica glass plus Aluminium
oxide for compressive strength
Hybrid matrix for elasticity
ZnO and F ¯
for biocompatibility

CAD/CAM
BLOCK

Manufacturing
Process

Flexural Strength
Biaxial Three Point

Compressive
Strength

Flexural
Modulus

Surface
Hardness

Vita Enamic

Dispersed, chemical cured
ceramic fillers

n/a

155 MPa

n/a

30 GPa

n/a

Lava Ultimate

Chemical cured ceramic
fillers (methcrylate based)

n/a

204 MPa

383 MPa

12.8 GPa

n/a

BRILLIANT Crios

Chemical cured ceramic
fillers (methcrylate based)

262 MPa

198 MPa

426 MPa

10.3 GPa

n/a

Shofu HC

Chemical cured ceramic
fillers (methcrylate based)

n/a

191 MPa

472 MPa

9.6 GPa

66 HV

Tetric CAD

Chemical cured ceramic
fillers (methcrylate based)

273.8 MPa

n/a

n/a

10.2 GPa

n/a

Cerasmart

Dispersed, chemical cured
ceramic fillers

246 MPa

n/a

n/a

9.6 GPa

n/a

Laser cured and sintered
glass phase

320 MPa

200 MPa

550 MPa

20 GPa

100 HV

* edelweiss internal data (ISO 4049) • Source: Technical data from manufacturer`s documentation.
Registered trademarks of VITA Zahnfabrik GmbH & Co. KG, Coltène AG, Ivoclar Vivadent AG, Shofu Dental Corporation, 3M Deutschland GmbH, GC Europe N.V.

Convince yourself and tr y our products at a live hands-on station at the edelweiss booth.
We are happy to welcome you at Hall 11.3, Stand D040 – E041.
www.edelweissdentistr y.com

[32] =>

/&-7*.)Ƴ
/&-7*)*38&1'&9*70425*8*3>

:47'*7*.8*8&9+).*>9093+8
&KGPCVKQPCNGWPFKPVGTPCVKQPCNG&GPVCNHCOKNKGCNNGHTGWGPUKEJCWHFKG+&5WPFFGPVCNDCWGTICP\DGUQPFGTU
/GJTFGPPLGIGYKPPVRGTUÒPNKEJG2TÀUGP\CNNGTJÒEJUVGP5VGNNGPYGTV&CUIKNVCWEJHØTFKGDGFGWVGPFUVG&GPVCNOGUUGFGT9GNVOKVFGO
(QMWUCWH+PPQXCVKQPGPWPF6TGPFU'KP6TGHHRWPMVXQPKPVGTPCVKQPCNGP(CEJNGWVGPWPF$TCPEJGPMGPPGTPOKVIGIGPUGKVKIGOHCEJNKEJGOWPF
MQNNGIKCNGO#WUVCWUEJ
5QOKVMQOOVFKGUG.GKVOGUUGHØTFKGFGPVCNDCWGTITWRRGIGPCWKOTKEJVKIGP/QOGPV#NUXQNNWOHCUUGPFGTFGPVCNGT(CEJJÀPFNGT*GTUVGNNGTXQP
RNWNKPGWPF.QIKUVKMFKGPUVNGKUVGTDGITØ»GPYKTWPUGTGPCVKQPCNGPWPFKPVGTPCVKQPCNGP-WPFGPUQYKG)GUEJÀHVURCTVPGTRGTUÒPNKEJCPWPUGTGO
/GUUGUVCPF'KP*CNNG&KGOWNVKMWNVWTGNNGFGPVCNG2NCVVHQTOUQNNKPHQTOKGTGPDGUVGJGPFG-QPVCMVGXGTVKGHGPWPFPGWG-QPVCMVGUEJCHHGP
9KTTGKUGPFCJGTOKVFGODGTØJOVGPFGPVCNDCWGT6GCOURKTKVPCEJ-ÒNPWOWPUGTG)GUEJÀHVUHGNFGT\WRƃGIGPYGKVGT\WGPVYKEMGNPWPFWO
MØPHVKIG#NNKCP\GP\WGTYGKVGTP
&CJGTHTGWGPYKTWPUICP\DGUQPFGTUCWH+JTGP$GUWEJ





=*&74+.)=*&74+)*38&1'&9*7*<5*78.*

57*5&7*)+478-*+9897*
$QVJVJGPCVKQPCNCPFKPVGTPCVKQPCNFGPVCNHCOKN[CTGNQQMKPIHQTYCTFVQ+&5CPFFGPVCNDCWGTKPRCTVKEWNCT
/QTGVJCPGXGTRGTUQPCNRTGUGPEGKUQHWVOQUVKORQTVCPEG6JKUCNUQCRRNKGUVQVJGYQTNFnUOQUVKORQTVCPVFGPVCNVTCFGHCKTYKVJVJGHQEWU
QPKPPQXCVKQPUCPFVTGPFU#ICVJGTKPIQHKPVGTPCVKQPCNFGPVCNGZRGTVUCPFKPFWUVT[KPUKFGTUYKVJOWVWCNRTQHGUUKQPCNCPFEQNNGIKCNGZEJCPIG
6JWUVJKUNGCFKPIVTCFGHCKTEQOGUCVGZCEVN[VJGTKIJVOQOGPVHQTVJGFGPVCNDCWGTITQWR#UCHWNN[EQORTGJGPUKXGFGPVCNURGEKCNKUVFGCNGT
OCPWHCEVWTGTQHRNWNKPGCPFNQIKUVKEUUGTXKEGRTQXKFGTYGYGNEQOGQWTPCVKQPCNCPFKPVGTPCVKQPCNEWUVQOGTUCUYGNNCUDWUKPGUURCTVPGTU
VQQWTGZJKDKVKQPUVCPF'KP*CNN6JGOWNVKEWNVWTCNFGPVCNRNCVHQTOKUFGUKIPGFVQKPHQTOFGGRGPGZKUVKPIEQPVCEVUCPFETGCVGPGY
EQPVCEVU9GCTGVJGTGHQTGVTCXGNNKPIVQ%QNQIPGYKVJVJGYGNNMPQYPFGPVCNDCWGTVGCOURKTKVKPQTFGTVQOCKPVCKPCPFHWTVJGTFGXGNQRQWT
DWUKPGUUƂGNFUCPFVQGZRCPFHWVWTGCNNKCPEGU
9GCTGNQQMKPIHQTYCTFVQUGGKPI[QWVJGTG

)*38&1'&9*7,2'-

-&11*8&3)*

)*38&1'&9*7

)*38&1)*548'*7&893,51&393,*7:.(*

[33] =>

THE NEW
DENTISTRY STANDARD
PreXion3D EXPLORER Series and EXPEDITION.
PreXion 3D CBCT combines precise imaging and low radiation with large
field of view capability and a first-of its kind incorporated cephalometric x-ray.

T DS
E
I
E
t
M Sa
59
0
U 1.1 58/B
ll 1 h A0
a
h ot
bo

EXPEDITION
Newly in house developed
IGZO FPD bulit in

EXPLORER PRO
The cephalometric x-ray
integrated without any
upgrade

EXPLORER
One of largest 15 x 16 cm FOV
without any stitching

prexion.co.jp

prexion.eu

prexion.com

PreXion Corporation (Japan) www.prexion.co.jp PreXion (Europe) GmbH (Germany) www.prexion.eu PreXion Inc. (USA) www.prexion.com

[34] =>

industry

EXOCAD PRÄSENTIERT DIE HIGHLIGHTS VON DENTALCAD, EXOPLAN UND CHAIRSIDECAD
EXOCAD PRESENTS DENTALCAD, EXOPLAN AND CHAIRSIDECAD HIGHLIGHTS

1: DentalCAD. 2: ChairsideCAD. 3: Exoplan.

Die exocad GmbH, ein Unternehmen von Align Technology, präsentiert auf der IDS 2023 ihre oﬀenen
Softwarelösungen unter dem Motto
„Imagine the CADabilities“. „Unsere
Software-Experten werden vor Ort
sein und das gesamte exocad-Softwarepaket im Einsatz zeigen“, sagte
Novica Savic, Chief Commercial Ofﬁcer und Geschäftsführer bei exocad.
Zu den aktuellen Anwendungen für
Dentallabore und -praxen gehören
DentalCAD, ChairsideCAD und exoplan. Alle Softwareanwendungen
von exocad greifen nahtlos ineinander und lassen sich mit zusätzlichen
Modulen erweitern. Die Besucher
können sich auf neue Funktionen in
der neuen Release-Serie 3.1 Rijeka
freuen.

DentalCAD
DentalCAD von exocad ist eine
der führenden CAD-Softwareanwendungen für Labore. Speziell für Zahntechniker entwickelt, bietet DentalCAD Produktivität und Flexibilität
beim Design hochwertiger Zahnrestaurationen. Mit mehr als 45 neuen
und über 85 verbesserten Funktio-

nen ist die neue Version 3.1 Rijeka
ein weiterer Meilenstein in exocads
Mission, Workﬂows zu optimieren
und die Produktivität zu steigern.

ChairsideCAD
ChairsideCAD ist die erste komplett oﬀene CAD-Softwareplattform,
die Restaurationen – vom Scan über
das Design bis zur Fertigung – in
nur einer Sitzung beim Zahnarzt ermöglicht. Die Software führt Anwender Schritt für Schritt durch den
Designprozess, lässt sich mit einem
breiten Spektrum von Geräten integrieren und bietet nahtlosen Informationsaustausch zwischen Praxen
und Laboren. ChairsideCAD-Anwender können die integrierte Kommunikationsplattform dentalshare nutzen, um mühelos mit Laboren ihrer
Wahl zusammenzuarbeiten.

Exoplan
Implantologie ist ein integraler
Bestandteil der modernen Patientenbehandlung. Mit exoplan werden Dentallabore, Zahnärzte, Implantatspezialisten und Chirurgen
von der Implantatplanung über das

Design der Bohrschablone bis hin
zur Fertigung in einem intuitiven,
digitalen Workflow geführt. Die
integrierten Softwarelösungen von
exocad ermöglichen nahtlose Funktionalität im gesamten digitalen
Workﬂow.
Wer mehr darüber erfahren
will, wie sich die Produktivität
mithilfe der führenden CAD/CAMSoftware steigern lässt, ist am
exocad-Stand genau richtig.
Exocad, an Align Technology company, is presenting open-platform
solutions at IDS 2023 under the
motto “Imagine the CADabilities”.
“Our software experts will be on-site
to show the entire exocad software
package in use,” said Novica Savic,
chief commercial oﬃcer and general
manager at exocad. Current software
for dental laboratories and practices
include DentalCAD, ChairsideCAD
and exoplan. All exocad software
solutions blend seamlessly together
and can be built out with additional
modules. IDS visitors can look forward to new features in the new
3.1 Rijeka release series.

DentalCAD

Exoplan

Exocad’s DentalCAD is one of the
leading dental CAD software programs, thousands of licences being
sold each year. Speciﬁcally designed
for dental technicians, DentalCAD
oﬀers productivity, ﬂexibility and the
ability to create outstanding dental
restorations. With more than 45 new
and over 85 enhanced features, the
new 3.1 Rijeka release marks another
milestone in exocad’s continuous optimisation of workﬂows for increased
productivity.

Implantology is an integral part
of modern patient treatment. With
exoplan, dental laboratories, dentists, implant specialists and surgeons are guided from implant planning to surgical guide design and
manufacturing in one intuitive digital workﬂow. Exocad’s integrated
software solutions allow for seamless functionality across the digital
workﬂow.
For visitors who want to learn
more about how to increase productivity with the help of the leading
dental CAD/CAM software, the
exocad booth at IDS is the right
place to be.

ChairsideCAD
Based on exocad’s laboratory
software, DentalCAD, ChairsideCAD
is the ﬁrst complete open-architecture
CAD software platform for single-visit
dentistry. The software includes a
step-by-step guide through the design
process, simple integrations with a
broad spectrum of devices and the
ability to seamlessly share information
between clinicians and laboratories.
ChairsideCAD users can take advantage of the integrated communication
platform dentalshare to easily collaborate with laboratories of their choice.

exocad, Germany
www.exocad.com/ids
Hall 1.2
Booth A040/C041

Magazine
Subscription

cosmetic dentistry

For free digital editions, use QR code
and online registration
For print subscriptions, contact
info@dental-tribune.com
*Fees apply

Magazine
Subscription
For free digital editions, use QR code
and online registration
For print subscriptions, contact
info@dental-tribune.com
*Fees apply

3D printing
— international magazine of
dental 3D-printing technology

FEIERN SIE 100 JAHRE IDS UND 30 JAHRE BEGO IMPLANTATGESCHICHTE
MIT UNS CELEBRATE 100 YEARS OF IDS AND 30 YEARS OF BEGO IMPLANT
SOLUTIONS WITH US
Bei BEGO erhalten Sie sämtliche Produkte für eine ﬂexible
und sichere Komplettversorgung
aus einer Hand – von der Planung bis zur Prothetik. Unsere
Fachkompetenz über den
gesamten digitalen Workﬂow mit integrierten, aufeinander ab gestimmten
Produkt- und Ser vicelösungen sind „made in
Germany for the world“
und runden unser Angebot
ab. Einzigartig umfassend ist
auch das Garan tie programm
von BEGO, das neben dem Gratisschutz der BEGO Security
Basic die Rundum-sorglos-Garantie BEGO Security Plus beinhaltet.
Als absolutes Highlight auf
der IDS 2023 präsentieren wir
Ihnen in unserer Live-Arena
erstmalig die Welt des SMART
Veneerings. Entdecken Sie die

unglaubliche Vielzahl von einzelnen Lösungsansätzen für
einen ganzheitlichen Workﬂow.
Sie können spannende Workshops erleben und selbst aktiv
werden.
Besuchen Sie unseren
Stand, feiern Sie mit uns
und entdecken Sie unsere
Jubiläumsangebote.
BEGO is your full-service
provider for ﬂexible and safe
complete restorations―from
surgical planning to prosthetics.
Our dental expertise throughout
the entire digital workﬂow with
integrated, well-coordinated
product and service solutions
that are “made in Germany for
the world” complement our
portfolio. Get to know the
unique, all-round carefree
guarantee for BEGO implant
restorations.

40th International Dental Show 2023 • 16. März 16 March

A highlight at IDS
2023 is our live arena,
at which we are presenting the world of
SMART Veneering for the
ﬁrst time. Discover the incredible variety of individual solutions for a holistic
workﬂow. You will have the
opportunity to attend exciting workshops and get involved yourself.
Visit our booth, celebrate
with us and discover our anniversary oﬀers.

BEGO, Germany
www.bego.com
Hall 10.2
Booth M010/N019

[35] =>

Ȋ%"#&/01   +20"
&+"3"/6-1&"+1--,&+1*"+1ȋ

%" +ǔ")) ,**2+& 1&,+%2

) Ȏ./*+.*'0/$*)
!*-Ǔ$(" .
ǐǔ.).ǻ
/ ''Ǻ.#*2ǐ*Ǿ

Ȇ$/#ǐ$ #1 '' ) 
/*0$')+- . )/(4!$)$)".Ǻ*+/$*).
)/- /( )/+').ǹ$(+'$!4$)"+/$ )/
*((0)$/$*)) )"" ( )/ǹȇ
/!,)#,,-"0Ǿ
Ǿ Ǿ%

&01%" ,*&+1&,+,#ǘ1" %+,),$&"0ǿ
Ǘ *"/Ǿǘ0 ++"/+!1%" +ǔ")) ,**2+& 1&,+%2Ǿ
-/,3&!&+$"06#,)),4Ȓ2-Ǿ1/ (&+$ǔ ,**2+& 1&,+
1, ),0")6*,+&1,/1%""3,)21&,+,#1%"-1&"+1Ȇ0%")1%ǽ

[36] =>

industry

NTI-KAHLA: DIAMOND EXPERTS SINCE 1996

Wir sind seit 27 Jahren Experten für die Entwicklung
und Herstellung von rotierenden Instrumenten. Durch
unsere innovativen Produktions- und Diamantierungsverfahren erhalten Sie bei NTI-Kahla die hochwertigsten Instrumente für Ihre Zahnarztpraxis oder Ihr Dentallabor. Unser umfangreiches Sor timent an Diamantschleifern mit 60 Grundformen, in bis zu sechs Körnungen und bis zu 14 Durchmessern, deckt alle erdenklichen Anwendungen ab. Besonders unsere innovativen
Lösungen zur Bearbeitung von Zirkondioxid sowie von
Hohlkehl- und Inlaypräparationen erleichtern den Arbeitsalltag von Behandlern und Technikern erheblich.
In unserem Sortiment ﬁnden Sie darüber hinaus exzellente Polierer für alle Dentalmaterialien, Hartmetallfräser, Hartmetallbohrer, Kronentrenner für Zirkondioxid
und Metalle, chirurgische Instrumente, Instrumente für
die Kieferorthopädie und vieles mehr.

Sie möchten mehr erfahren?
Besuchen Sie uns auf der Internationalen DentalSchau in Halle 11.2 am Stand L008 und nutzen Sie direkt

Ihren persönlichen IDS-Gutschein: Der Gutschein in
Höhe von 25 Euro ist vom 14. bis 18. März 2023 gegen
Vorlage auf unserem IDS-Messestand und ab einem
Warenwert von 150 Euro einlösbar.

Sie sind nicht auf der IDS? Kein Problem!
Wir freuen uns auf Ihren Anruf unter der Telefonnummer +49 36424 5730 oder Ihre E-Mail an verkauf@
nti.de. Nutzen Sie ebenfalls unseren Onlineshop unter
www.nti.de. Hier ﬁnden Sie neben allen Produkten und
Preisen nützliche Funktionen, welche Ihren Bestellvorgang und die Verwaltung erleichtern.

NTI-Kahla, Germany
www.nti.de
Hall 11.2
Booth L008

ALIGNER-FERTIGUNG IN FLEXIBLER STÜCKZAHL MIT DER D100+ CABINET
VON RAPID SHAPE
ALIGNER PRODUCTION IN FLEXIBLE QUANTITIES WITH D100+ CABINET
FROM RAPID SHAPE
In der additiven Fertigung geht es zunehmend um
Automatisierung sowie Produktion in hoher Stückzahl.
Qualität, Präzision, Zeit- und Kosteneinsparung sind
dabei zu berücksichtigende Features und Rapid Shape,
deutscher Hersteller innovativer 3D-Drucker, geht hier
selbstbewusst voran. Mit dem 3D-Drucker D100+ Cabinet
ist eine ﬂexible Fertigung, beispielsweise von individuellen Aligner-Modellen, in skalierbarem Umfang möglich. Der 3D-Drucker erfüllt die Anforderungen an einen
großen Druckbereich, validierte Orthomodelle sowie
Aligner-Präzision. Dauerhafte Qualität machen ihn zu
einer 24/7-Produktionseinheit. Als Einzellösung oder in
Verbindung mit einer Produktionslinie liefert der 3DDrucker D100+ Cabinet perfekte Ergebnisse. Für eine
echte Serienproduktion ohne unnötige Ausfallzeiten.
Additive manufacturing is increasingly about automation as well as high-volume production. Features to be
taken into consideration include quality, precision, and
time- and cost-savings, and Rapid Shape, a German man-

ufacturer of innovative 3D printers, is conﬁdently leading
the way. The D100+ Cabinet 3D printer allows for ﬂexible
and scalable manufacturing of custom aligner models,
among others. The D100+ Cabinet 3D printer fulﬁls the
requirements for a large print area, as well as for validated orthodontic models and models for aligner production. Durable quality makes it suitable for 24/7 production. As a stand-alone solution or in combination with a
production line, the 3D printer delivers perfect results for
series production without unnecessary downtime.
Rapid Shape is presenting all its 3D printers and
post-processing devices at IDS. Get to know its 3D printers
and learn more about the smart connections between all
the devices.
Rapid Shape, Germany
www.rapidshape.de
Hall 4.2
Booth K089

[37] =>

IN CASES OF MOUTH ULCERS AND LESIONS OF THE ORAL MUCOSA

QUICK RELIEF,
QUICK HEALING.
It forms a lipid-protective ﬁlm on the wound.

RELIEVES
pain quickly

STIMULATES
cellular repair

They are Medical Devices

ACCELERATES
healing

. Read the warnings and instructions for use carefully.

[38] =>

industry

NEUE STRAHLENSCHUTZVERORDNUNG:
MIT CARESTREAM DENTAL IMMER AUF DER SICHEREN SEITE
Gemäß § 114 der Strahlenschutzverordnung muss nun jedes neu in
Verkehr gebrachte Röntgengerät
über eine Funktion verfügen, welche
die Röntgendosis elektronisch aufzeichnet und so für die Qualitätssicherung ebenfalls elektronisch
nutzbar macht. In der Vergangenheit war eine Aufzeichnung der
Strahlendosis mithilfe der Produkte
von Carestream Dental möglich,
verlief jedoch nicht automatisiert
und erfüllte daher nicht die neuen
Anforderungen. Um der Gesetzes-

änderung nun gerecht zu werden,
hat Carestream Dental eine aktualisierte Software-Version der CS Imaging 8 entwickelt. Diese kann mit
jeder digitalen, intraoalen Bilderfassungsmethode des aktuellen Produktangebots verwendet werden.
Das bedeutet ganz konkret, dass
Carestream-Kundinnen und -Kunden
mit dem Produktportfolio der Sensoren RVG 5200 und RVG 6200 sowie der Speicherfoliengeräte CS 7200
und CS 7600 im Zusammenspiel mit
der neuen Version der CS Imaging

Version 8 gesetzeskonform arbeiten
können. Bei jeder Aufnahme werden die Daten über die Dosis automatisch in das bestehende, im CS
Imaging 8 eingebettete radiologische
Protokoll aufgezeichnet. Diese ermittelte Dosis können Technikerinnen und Techniker dann anhand
eines Aluminiumphantoms mit der
gemessenen Dosis vergleichen. Für
Kundinnen und Kunden, die Geräte
nutzen, die bereits im vergangenen
Jahr in Betrieb waren, ändert sich
nichts. Sie können ihre Geräte weiter wie gehabt verwenden. Liegt ein
Defekt vor, so gibt es zwei mögliche
Szenarien: Wird beispielsweise nur
ein Bauteil des Gesamtgerätes durch
ein neues ersetzt, muss gemäß der
neuen Anforderung der elektronischen Speicherung der Dosis keine
Rechnung getragen werden. Wird
jedoch das Gerät vollständig ausgetauscht, gilt dies als neue Inbetriebnahme und unterliegt somit der
aktualisierten Gesetzgebung.

Carestream Dental,
Germany
www.carestreamdental.de
Hall 10.2
Booth L040/M041

EDENTA PRÄSENTIERT DIAMANTSTREIFEN ZUR
APPROXIMALEN SCHMELZREDUKTION
EDENTA PRESENTS ORTHODONTIC DIAMOND
FINISHING STRIPS
Die doppelseitig belegten Diamantstreifen von Edenta ermöglichen eine einfache und präzise
approximale Schmelzreduktion –
auch Strippen oder Rekonturierung
genannt. Dabei, wird ein Teil des
Zahnschmelz-Mantels entfernt, um
genügend Platz für die kieferorthopädische Ausrichtung zu gewinnen. Die ﬂexiblen Streifen biegen sich entlang der natürlichen
Konturen der Zähne für eine optimale Oberﬂächengestaltung.
Die Diamantstreifen sind in
vier verschieden Stärken erhältlich:
0,1; 0,2; 0,3 und 0,4 mm. Drei verschiedene Körnungen entsprechend
der Farbcodierung sind lieferbar:
gelb für superfeine Körnung, rot
für feine Körnung und blau
für mittlere Körnung. Die rostfreien Streifen sind autoklavierbar und wiederverwendbar.

thicknesses: 0.1, 0.2, 0.3 and 0.4 mm.
Three diﬀerent grit sizes are available: yellow for superﬁne grit, red for
ﬁne grit and blue for medium grit
according to the colour coding. The
stainless-steel strips can be autoclaved and reused.

Edenta Etablissement,
Liechtenstein
www.edenta.com
Hall 11.3
Booth A060/B069

Diamond-coated on both sides,
Edenta’s ﬁnishing strips enable simple and precise reduction of the interproximal tooth substance, also referred to as stripping or recontouring.
The ﬂexible strips follow the natural
contours of the teeth to provide optimal surface design. The diamond
ﬁnishing strips are available in four

EXISTENZGRÜNDUNG BRAUCHT ZUVERLÄSSIGE PARTNER YOUR RELIABLE PARTNER FOR SETTING UP YOUR OWN PRACTICE
Endlich der eigene Chef sein! Diesen Wunsch
haben viele junge Zahnärztinnen und Zahnärzte. Nach dem Ende der Assistenzzeit oder
einigen Jahren Berufserfahrung stellt sich die
Frage, ob eine Neugründung oder Praxisübernahme infrage kommen oder wie der weitere
Berufsweg geplant wird. Fällt die Entscheidung für eine eigene Praxis, geht es erst richtig los: Gründer müssen sich mit einer Vielzahl an Themen und Herausforderungen auseinandersetzen, die mit Zahnmedizin selbst
zunächst wenig zu tun haben. Da kann man
als Berufseinsteigerin oder -einsteiger schnell
den Überblick verlieren, denn man lernt in
Studium und Assistenzzeit zwar viel über das
komplette Spektrum der Zahnmedizin, aber
vergleichsweise wenig über die Themen Praxisgründung und Finanzierung, die aber die
Basis für eine Existenzgründung sind. Für die
Selbstständigkeit sind sowohl fachliches als

auch unternehmerisches Know-how notwendig. Dafür braucht es kompetente Partner.
Ein solcher starker und zuverlässiger Partner, der bei allen Fragen, Herausforderungen
und Problemen unterstützt, die innerhalb des
Gründungsprozesses aufkommen, ist dental
bauer. Mit existKONZEPTdb begleitet Sie dental
bauer vertrauensvoll und kompetent auf Ihrem
Weg zur Praxisgründung. Gemeinsam geht es
mit individuellen Lösungen auf Erfolgskurs.
Von der Unterstützung bei allen Anliegen rund
um die Etablierung eines stimmigen Praxisund Designkonzeptes über die Beratung zum
Thema Nachhaltigkeit bis zur Bereitstellung eines umfangreichen Sortiments an Materialien
und Equipment namhafter internationaler Dental-Hersteller bietet dental bauer ein Rundumsorglos-Paket weit über den Gründungsprozess
hinaus. Vor allem die Leistungssparte DESIGNKONZEPTdb mit den beiden stilvoll designten
Behandlungseinheiten bluemarina und Bella
Vita mit jeweils passenden Möbelsystemen überzeugt Gründerinnen und
Gründer gleichermaßen.
Eine große Herausforderung für
angehende Praxisinhaberinnen
und -inhaber – wobei die Zahl
der Zahnärztinnen stetig steigt –
ist es, die richtigen Entscheidungen zum richtigen
Zeitpunkt zu treﬀen. Den
Wunsch, im Beruf selbstbestimmt agieren zu können sowie Unternehmertum
und Zahnmedizin zu kombinieren, muss mit der Familienplanung vereinbar sein.
Dabei gibt es viele Mittel
und Wege, die Familie und
die eigene Praxis miteinander zu verbinden. Neben
den allgemeinen Seminarangeboten zu den

Themen Existenzgründung und Praxisübernahme unterstützt Sie das Team von dental
bauer aktiv bei allen Herausforderungen rund
um die Praxisgründung. Weitere Informationen
dazu ﬁnden Sie unter www.dentalbauer.de/
unsere-leistungen/existkonzept.
Be your own boss! This is what many young
dental professionals desire. After the end of
their residency or some years of work experience, the question arises for every dentist
whether starting a new practice or taking over
a practice is an option. Once you have decided
to set up your own practice, this is where the
real work begins: practice founders must deal
with a number of issues and challenges that
have little to do with dentistry to begin with. It
can become complicated to stay on top of
things because, although one learns a lot about
treating patients at university and during residency, dentists learn comparatively little about
practice planning and ﬁ nancing, which are
crucial aspects setting up a practice, however.
When you decide to start your own practice,
you are no longer just a dentist but also an entrepreneur. This requires competent partners.
dental bauer is your strong and reliable
partner, who supports you in solving all questions, challenges and problems, which may
arise during the establishment process. With
existKONZEPTdb, dental bauer accompanies
founders trustfully and competently on their
way. Individual solutions pave the way to success. From support in all matters related to the
establishment of a coherent design concept to
advice on sustainability and the provision of
an extensive range of materials for everyday
use in the dental practice from well-known international dental manufacturers, dental bauer
oﬀers an all-round carefree package well beyond the start-up phase. The service line
DESIGNKONZEPTdb in particular, including the
two stylish treatment units bluemarina and

40th International Dental Show 2023 • 16. März 16 March

Bella Vita as well as their matching furniture
systems, convinces founders.
A major challenge for prospective practice
owners—with a steadily increasing number of
female dentists—is making the right decisions
at the right time. The desire to act independently
in one’s job and to combine entrepreneurship
and dentistry must be in line with family planning. There are many ways and means of balancing family and practice. In addition to general
seminars about dental practice ownership or
taking over a practice, the dental bauer team offers active supports for tackling all challenges
related to these topics.

dental bauer, Germany
www.dentalbauer.de
Hall 10.1
Booth E050

[39] =>

IDS 2023

AUF BEGO KÖNNEN SIE ZÄHLEN
über

560 1100
80 360
400 11.500
m2

über

STANDFLÄCHE

KOMPETENTE GESPRÄCHSPARTNER
FÜR SIE TÄGLICH

FACHVORTRÄGE

LIVE DEMONSTRATIONEN

über

über

über

YOUTH-BOAT-BUCHUNGEN
DES DENTALEN NACHWUCHSES

GEDRUCKTE KRONEN
FÜR SMART VENEERING

Überzeugen Sie sich selbst auf der IDS 2023
Halle 10.2 Stand M-010 / N-019
www.bego.com

Miteinander zum Erfolg

[40] =>

industry

TIPS FOR CHOOSING THE BEST ENDODONTIC SUPPLIER
Market research shows that the endodontic ﬁles market is expected to
grow at a compound annual growth
rate of over 5% during the period
2019–2023. Indeed, the market of endodontic ﬁles is increasing, and this
growth can be attributed to new advancements in technology and increased safety, ﬂexibility and eﬃciency. However, the question is: how
can one ﬁnd the best endodontic supplier?
The factors that should be considered are product quality, price and
supplier capacities. First of all, when
it comes to product quality, the most
important factor to consider is the
quality of the rotary ﬁles. Not all rotary ﬁles on the market have the
outstanding quality that is necessary
for an improved patient experience.
Secondly, price is always an important factor. Here, the goal is to
choose a supplier that provides the best
quality at a reasonable price. That
way, your purchase will pay for itself.
Thirdly, it is important to take into
account a supplier’s production as
well as research and development
capacities. Ideally, a supplier should
have an extensive production capacity and be able to produce thousands

of rotary ﬁles a day. Why? Low production capacity can mean that customers must wait a long time before
they receive ordered ﬁles. At the
same time, research and development capacity speaks volumes about
the supplier’s ability to innovate and
to introduce new and improved products.

Why is Dental Perfect a
great choice?
Dental Perfect was founded in
2008 and has gained extensive experience in the dental industry. Since
its founding, the company has relied
on innovative approaches and the latest technology to enhance the quality
of its products and to raise produc-

tivity to a whole new level. This has
been a success—today, Dental Perfect
produces over 45,000 taper ﬁles per
day.
High product quality and adherence to the latest market requirements and regulations has gained
the company a good reputation. What
is more, Dental Perfect’s high-quality

rotary ﬁles are available at reasonable prices. Visit the company at IDS
to ﬁnd out more!

suﬃcient bone structure. It is the only
narrow-body implant with a screw-retained prosthetic system. It has received U.S. Food and Drug Administration clearance for long-term use,
has been validated for permanent use
and is supported by over 20 years of
clinical research.
The Atlas implant has been designed for long-term use to retain and
stabilise dentures. Eliminating the
hardware typically associated with
overdentures, the Atlas system uses
no O-rings, housings or adhesives. Instead, the unique Tuf-Link silicone relining material is mechanically secured within the denture by an
undercut and provides a cushioned
ﬁt for stress-free denture insertion,
retention and removal.

plied lingually or buccally for ﬁrm
adaptation of the matrix band to the
tooth and promote secure retention
and ease of use. Dentatus matrix
bands are manufactured from the
highest-quality stainless steel and have
perfectly smooth edges. The company’s special series Class V matrix
bands are especially useful in recreating gingival margins of Class V restorations.
Visit the Dentatus booth to gain
more insights into our products and
learn more about our specials!

Dental Perfect, China
www.dental-perfect.com/doctor
Hall 11.1, Booth D021

DENTATUS: QUALITY SOLUTIONS FOR DENTISTRY AND THE WORLD
Founded in 1930, Dentatus has
been developing, manufacturing and
supplying unique dental solutions for
over 95 years. Since its inception, the
company has pioneered numerous
groundbreaking products, including
precision articulators introduced in
1944 and the ﬁrst prefabricated classic metal post, which has become an
industry standard.
Dentatus believes that true quality means creating solutions that are
good not only for dentistry but also
for the environment. At the heart of
Dentatus is a commitment to providing sustainable, high-quality products
without compromise.

Profin reciprocating system
For shaping, contouring and polishing natural dentition and cosmetic
restorations with ease and ﬂexibility,
Proﬁn is clinicians’ system of choice.
Proﬁn consists of contra-angle handpieces and Lamineer diamond-coated
tips. The handpieces move in an axial direction with reciprocating mo-

tion (1.2 mm stroke). Thanks to their
thin design, the tips provide optimal
access to areas that are diﬃcult to
reach, and the one-sided diamond coating promotes safety and control.
The Lamineer tips are available
in a variety of shapes, sizes and grits,
making Proﬁn perfect for everything
from routine hygiene and periodontal
care to orthodontics, cosmetic dentistry and CAD/CAM restorations.
In 2022, Dentatus introduced the
Complete IPR Solution for quick and
eﬃcient interproximal reduction (IPR)
procedures, saving time, improving
patient comfort, reducing clinician
stress, ensuring treatment compliance and delivering predictable, successful treatment results consistently. The IPR tips are calibrated for
the amount of reduction, enabling
precise results without the use of an
additional gauge. The tips are colour-coded by tip thickness and are
double-sided for maximum eﬃciency.
The Complete IPR Solution is compatible with all aligner systems and

was launched in anticipation of the
growth of the global clear aligner market. This is also reﬂected in Dentatus’s
special oﬀer at IDS: Proﬁn PDX contraangle handpiece with IPR tips starter
kit at a reduced cost of €237.34 (SRP).

Post systems
Surtex Classic posts are the
global standard for post systems, offering dentists consistently reliable
solutions for post and core buildups. These high-quality prefabricated
metal posts are both dependable and
economical.
Luscent anchors—the original
translucent posts—are made of unidirectional ﬁbreglass rods encapsulated in a strong resin matrix. They
enable aesthetic, long-lasting restorations and feature excellent strength
characteristics.

Implant systems
The Dentatus Anew narrow-body
implant is the best treatment option
for patients lacking time, money or

Matrix system
Based on the inventor’s original
design, Nyström matrix retainers and
Dentatus matrix bands oﬀer dentists
a complete system for everyday reliability. Nyström retainers can be ap-

Dentatus, Sweden
www.dentatus.com
Hall 10.1
Booth G070/H071

From left: Proﬁn reciprocating system, Complete IPR Solution (Proﬁn PDX contra-angle handpiece with the IPR tips kit), gold Surtex Classic post, Luscent anchors, Dentatus Anew narrow-body implant, Atlas implant and matrix system.

40th International Dental Show 2023 • 16. März 16 March

[41] =>

Maximal aesthetics within a micro-layer?N
Initial IQ

Initial IQ

SQIN

Lustre Pastes ONE
The most versatile paintable
ceramic for external staining as well as
internal characterisation of substructures.
When used with SQIN, it also serves as the
connection ﬁring.

9 Ready-to-use
consistency
9 Inherent
ﬂuorescence
9 3D colour
deepness

Completes the
ﬁnal contour of
your restorations
offering vitality,
texture and natural
gloss.

9 Easy form and texture
9 Self-glazing effect
9 3D surface structure
Initial

Spectrum
Stains
Fine powder
stains for extra
individual effects.

9 Inﬁnite colour nuances
9 Can be mixed with Lustre Pastes ONE
or SQIN

WORKFLOW +OCIGUEQWTVGU[QH<6/5VGHCP4QQ\GP#WUVTKC

Monolithic
framework (Zr or
lithium disilicate)

Lustre Pastes ONE
Application & ﬁring
Colour &
ﬂuorescence

SQIN
Application & ﬁring
Form, texture &
gloss

Initial IQ ONE SQIN
Paintable colour-and-form
ceramic system

Solved with GC!
)%'7412'08
KPHQIEG"IEFGPVCN
JVVRUGWTQRGIEFGPVCNGP)$

DONE!

[42] =>

industry

CLEARCORRECT BRINGT UPDATES FÜR SEINEN LEISTUNGSFÄHIGEN DIGITALEN WORKFLOW AUF DEN MARKT
CLEARCORRECT LAUNCHES UPDATES TO ITS EMPOWERING DIGITAL WORKFLOW
ClearCorrect, die führende kieferorthopädische Marke der Straumann
Group, freut sich, neue und aktualisierte digitale Produkte anzukündigen, die auf der IDS eingeführt
werden. Diese Aktualisierungen von
ClearCorrect’s Empowering Digital
Workﬂow werden Behandlerinnen
und Behandlern helfen, komplexere
Fälle eﬃzient zu behandeln.
Die Markteinführung umfasst
ein verbessertes, dynamisches Verschreibungsformular, das zu optimalen Behandlungsprotokollen führt
und gleichzeitig erweiterte Anpassungsoptionen bietet. Zu den Funktionen gehören neue Behandlungsansätze, ein aktualisierter Datensatz-Uploader und ein geführtes Verschreibungsformular mit Optionen,
die dynamisch auf der Grundlage
der Komplexität des Falls, der Zahnbedingungen und der Behandlungspräferenzen angezeigt werden.
Zusammen mit dem neuen Verschreibungsformular wird ClearCorrect
die ClearCorrect Sync Mobile App
auf den Markt bringen, die es Behandlerinnen und Behandlern ermöglicht, schnell Patientenproﬁle
einzurichten, um neue Fälle zu erstellen, hochwertige Fotos mithilfe
von geführten Vorlagen zu machen,
Fotos mit intuitiven Werkzeugen zu
bearbeiten und die Möglichkeit zu
haben, Patientendaten und Fotos
direkt in das Doctor Portal hochzu-

laden. Der digitale Arbeitsablauf
wurde durch optimierte Integrationen mit zwei IOS-Plattformen weiter
verbessert – Virtuo Vivo und 3Shape
Unite.
Für die Unterstützung und Hilfe
bei der Behandlungsplanung wird
ClearCorrect Collaborator 4.0 einführen, eine aktualisierte Integration für die Partner-Funktion, die es
den Behandlerinnen und Behandlern ermöglicht, Behandlungsplanungsdienste direkt bei den globalen TPS-Partnern von ClearCorrect
zu bestellen.
Die neueste Aktualisierung des
digitalen Workﬂows umfasst die mit
Spannung erwartete Einführung von
ClearPilot 6.0. Diese Version bietet
eine Reihe von Upgrades, die Kundinnen und Kunden eine intuitivere
und benutzerfreundlichere Behandlungsplanung mit Funktionen wie

direkter Kollisions- und Platzbearbeitung und Punkt-zu-Punkt-Messwerkzeugen ermöglicht. Das Highlight
der Version ist jedoch eine verbesserte Benutzeroberﬂäche.
ClearCorrect lädt Besucherinnen und Besucher der IDS ein, zum
Straumann-Stand zu kommen, um
mehr zu erfahren und Partner zu
werden.
ClearCorrect, the Straumann Group’s
ﬂagship orthodontic brand, is excited
to announce new and updated digital
products launching at IDS. These updates to ClearCorrect’s empowering
digital workﬂow will help dental professionals to eﬃciently treat cases of
greater complexity.
Included in the launch is an enhanced, dynamic prescription form
that guides dental professionals towards optimal treatment protocols

while oﬀering advanced customisation options. Features include new
treatment approaches, an updated records uploader and a guided prescription form with options that display dynamically based on case complexity,
dental conditions and treatment preferences.
Alongside the new prescription
form, ClearCorrect is launching the
ClearCorrect Sync mobile app, allowing dental professionals to quickly
create new cases, take quality photographs and edit them using templates and intuitive tools, and upload patient data and photographs
directly to the dentists’ portal. The
digital workﬂow has been further
enhanced via optimised integration
with two intra-oral scanner platforms,
Virtuo Vivo and 3Shape Unite.
For treatment planning support
and assistance, ClearCorrect is launch-

ing Collaborator 4.0, an integration
that will allow dental professionals to
request treatment planning services
directly from ClearCorrect global
partners.
The ﬁnal update to the digital
workﬂow includes the launch of
ClearPilot 6.0. This release introduces a series of upgrades designed
to give dental professionals a more intuitive and user-friendly treatment
planning experience. Updated features include direct collision and
space editing with automated adjacent tooth adjustment as well as
point-to-point measurement tools.
However, the highlight of the release
is an improved user interface.
ClearCorrect invites dental professionals, dental practice staﬀ and
industry leaders to come to the
Straumann booth to learn more and
to become a partner.

ClearCorrect
(Straumann Group
brand), Switzerland
www.straumann.com/clearcorrect/
en/doctors
Hall 4.2
Booth G080/J089

TYSCOR – SAUGSYSTEME FÜR EINE NACHHALTIGE PRAXIS TYSCOR—SUCTION SYSTEMS FOR A SUSTAINABLE DENTAL PRACTICES
Mit Tyscor hat Dürr Dental die
Welt der zahnärztlichen Absaugung
nachhaltig verändert. In welchem
Ausmaß dies den Betrieb grüner
macht, wird nach und nach immer
deutlicher. Dank der konsequenten
Software-Anbindung der Saugsysteme proﬁtieren Umwelt und Praxis
von jedem Fortschritt in der digitalen Welt.
Rein technisch gesehen, hat Dürr
Dental einen Top-Industriestandard
für den zahnmedizinischen Bereich
nutzbar gemacht – die Radialtechnik.
Sie ersetzt bei der neuen SauganlagenGeneration die klassische Seitenkanalverdichtung. Für die Praxis bedeutet dies bis zu 75 Prozent Energieeinsparungspotenzial (gemessen an
der Tyscor VS 4 und einem vergleichbaren Seitenkanalverdichter durch
das Fraunhofer Institut). Das macht
sich in ﬁnanziell bemerkbar und senkt
gleichzeitig den CO2-Fußabdruck der
Praxis.

Als vorteilhaft für die Umwelt
erweist sich auch die Produktion der
Saugmaschinen. Das Produkt wird
regional am Standort BietigheimBissingen unter Einsatz von recycelbaren Materialien gefertigt.
Bei einer vorausschauenden Wartung proﬁtiert die Praxis von der
cloudbasierten Software VistaSoft
Monitor. Denn damit hat nicht nur
das Team selbst den Zustand seines
Equipments stets vom Praxis-PC, vom
Tablet zu Hause oder von unterwegs
vom Smartphone aus im Blick, sondern auch der zuständige technische
Service (zum Beispiel vom Dentaldepot). Etwaige Probleme eines Saugsystems werden erkannt, bevor es
zu einem Schadensfall kommt.
Durch die Skalierbarkeit der
Tyscor-Saugmaschinen passen sie
sich den Bedürfnissen der Praxis an.
So können Behandlungsplätze in der
Praxis erweitert werden – und das
ohne Austausch des Bestandsgerä-

tes. Auch können Probleme aus der
Ferne analysiert und durch die Fernwartung behoben werden. In diesem
Falle ist eine Anfahrt gespart – wieder ein Plus für die Umwelt.
Die Tyscor-Saugsysteme machen
die Praxis zu einem starken Pfeiler
für einen umweltfreundlichen Betrieb.
Mit diesem Produkt geht Dürr Dental
nicht nur einen wichtigen Schritt in
eine nachhaltige Zukunft, sondern
unterstützt auch seine Kundinnen
und Kunden durch die Energieeinsparung, Fernwartung und die
Skalierbarkeit der Produkte bei einer
nachhaltigen Praxisversorgung.
With its Tyscor suction system, Dürr
Dental has transformed the world of
dental suction completely. The extent
to which they are making dental practices greener is becoming increasingly
clear. Owing to the suction system’s
seamless integration with a practice’s
software systems, both the environment and practice beneﬁt from every
advance in the digital world.
From a purely technical point of
view, the technology that Dürr Dental
has harnessed for the world of dental
applications is simply one of the best
industry standards currently available―radial technology. With the latest
generation of suction systems, it has
now replaced conventional side channel compression. For dental practices,
this means potential energy savings
of up to 75% (measured on the Tyscor
VS 4 and a comparable side channel
blower by the Fraunhofer Institute),
which will help lower electricity costs

and reduce the CO2 footprint of the
practice.
The way in which the suction units
are produced is also beneﬁcial for the
environment. The product is manufactured regionally at the company’s headquarters in Bietigheim-Bissingen in
Germany using recyclable materials.
For predictive maintenance, practices can take advantage of the cloudbased software VistaSoft Monitor,
which allows team members or technical staﬀ (for example from a dental
equipment wholesaler) to check the status and condition of their equipment
at a glance at all times from any computer in the practice, a tablet at home
or via their smartphone. Potential problems with a suction system are detected
before the system is damaged or fails.
As the Tyscor suction units are
designed with scalability in mind, it is
really easy to adjust the system to
changing requirements in your dental practice. For example, you can ex-

40th International Dental Show 2023 • 16. März 16 March

pand the practice and add new treatment units―without the need to replace
the existing equipment. Similarly, it is
also possible to analyse problems remotely and ﬁx them via remote maintenance to save a visit to the practice,
which beneﬁcial for environment too.
With Tyscor suction units, the
way your dental practice is run oﬀers
strong support for the environment.
With this product, Dürr Dental has
taken an important step towards a
more sustainable future and therefore supports its customers in saving
energy, with remote maintenance and
scalability of the products in order to
make their practice more sustainable.

Dürr Dental, Germany
www.duerrdental.com
Hall 10.1
Booth E008/F029

[43] =>

[44] =>

industry

3SHAPE F8 ZWEIMODELL-LABORSCANNER 3SHAPE’S DUAL-MODEL F8 LABORATORY SCANNER
Der F8 Zweimodell-Laborscanner
ist das neueste Produkt im preisgekrönten 3Shape LaborscannerPortfolio. Dank seiner hohen Scangeschwindigkeit und seines innovativen oﬀenen Designs, das nur minimale Eingriﬀe erfordert, bietet er
Anwenderinnen und Anwendern
eine konkurrenzlose Leistung.
Der F8 hat keine Tür, was die Arbeit mit ihm beschleunigt. Darüber
hinaus verfügt der F8 über ein intuitiv oﬀenes Design mit magnetischen
Scanplatten und der Autostart-Funktion, was einen eﬃzienteren Scanarbeitsablauf garantiert. Beispielsweise wurde der Arbeitsablauf für
das Scannen eines Triple Tray und
Einzelstumpfs mit dem F8 einmal
mit 1 Minute und 34 Sekunden gemessen. Das ist 24 Prozent schneller
als unser Laborscanner D2000.
Der F8 ist der vielseitigste und
intuitivste Scanner, den das Unternehmen bislang entwickelt hat.
Mit diesem Scanner können Anwender eine ganze Reihe hochwertiger Dienstleistungen anbieten, einschließlich des Scannens kompletter
Artikulatoren, Triple-Tray-Abdrücke

F8 highlights

und Stümpfen im Modell. Außerdem proﬁtieren sie von der Option
des Scannens mit nur einem Klick.

F8-Highlights
• Höhere Eﬃzienz – reduziert den
manuellen Arbeitsaufwand mit
dem intuitiven Place-and-ScanDesign.
• Größere Vielseitigkeit – ermöglicht das Angebot eines kompletten Spektrums von hochwertigen
Dienstleistungen mit weniger Aufwand und einer ISO-zertiﬁzierten
Scan-Genauigkeit von 4 μm.
• Höhere Geschwindigkeit – dank
reibungsloser automatisierter Scanto-Design-Arbeitsabläufe können
Anwender ihre Fallzahlen besser
bewältigen. Ein Quadrant- und Einzelstumpf-Scan dauert 1 Minute
und 40 Sekunden – 21 Prozent
schneller als der Laborscanner
D2000. Ein Scan des vollständigen Zahnbogens (Ober- und Unterkiefer) mit dem Artikulator dauert
1 Minute und 59 Sekunden.*
* Die angegebenen Arbeitsablaufgeschwindigkeiten sind Beispiele, die auf einem einzigen
Arbeitsablauf basieren.

The dual-model F8 scanner meets
ISO 5725-1 standards and is the newest addition to the 3Shape award-winning scanner portfolio. It provides
users with unparalleled productivity
via its high scanning speed and its
innovative and open design that requires minimal hands-on interaction.
The F8 does not have a door,
which makes working with it extremely fast. Additionally, the F8’s intuitive magnetic place-and-scan open
scanner design and auto-start feature ensure a more eﬃcient scanning

workﬂow. For example, the F8 workﬂow for a triple tray and single die
scan has once been timed at 1 minute
and 34 seconds. That is 24% faster
than our D2000 laboratory scanner.
F8 is the most versatile and intuitive scanner that the company has
developed. It will enable users to
provide a complete range of quality
services to dental professionals, including upright articulator scanning,
one-click scanning, triple tray impression scanning and die-in-model
scanning.

• Greater eﬃciency—reduces handson time with intuitive place-andscan design.
• Greater versatility—enables delivery of a complete range of quality
services with less eﬀort and with
an ISO-documented scanning accuracy of 4 μm.
• Greater speed—helps users stay on
top of their caseloads with lean, automated scan-to-design workﬂows:
A quadrant (maxillary or mandibular) bite scan takes 1 minute and
40 seconds—21% faster than with
the D2000 scanner. A full-arch
(maxillary and mandibular) model
articulator scan takes 1 minute and
59 seconds.*
* The workﬂow speeds stated are examples
based on a single workﬂow.

3Shape, Denmark
www.3shape.com
Hall 4.2
Booth J098/K099

UPDATE FÜR BEWÄHRTE KAVO-INSTRUMENTE DER SERIEN EXPERTMATIC UND EXPERTTORQUE
UPDATE FOR TRIED-AND-TESTED EXPERTMATIC AND EXPERTTORQUE SERIES OF KAVO INSTRUMENTS
KaVo entwickelt nicht nur stetig

neue Produkte und dentale Innovationen, sondern perfektioniert auch
kontinuierlich sein bestehendes Portfolio. Selbst Produkte, die sich teilweise schon über viele Jahre im Praxiseinsatz bewährt haben, werden
regelmäßig für eine noch bessere
Performance, mehr Sicherheit und
mehr Freude im Praxisalltag optimiert. Die beliebte Instrumentenserie KaVo EXPERT hat nun ein solches KaVo „Exzellenz-Update“ erhalten. Diese steht seit ihrem ersten
Verkaufstag für Langlebigkeit, Eﬃzienz und intelligente, hochwertige
Produktdetails. Aber um allen Praxisanforderungen in einer sich
schnell verändernden Zeit stets zu
genügen und um das Produktversprechen rund um den KaVo Anspruch „Dental Excellence“ zu erfüllen, wurden die Schnellläufer und
Turbinen der KaVo EXPERT-Serie
mit neuen Features und technischen
Details noch weiter verbessert.

Ein kühler Kopf, HightechKugellager und mehr Power bei
geringerer Geräuschbelastung
Die KaVo EXPERTmatic E25 Lund E25 C-Schnellläufer gehören zu
den beliebtesten und meistverkauften KaVo Instrumenten. Smarte Features wie die Integration der KaVo
CoolHead-Technologie und die exklusiven Kugellager machen diese Topseller noch sicherer, robuster und
attraktiver.
Die CoolHead-Technologie verhindert aktiv die übermäßige Erwärmung des Instrumentenkopfes
bei unabsichtlicher Druckknopfbetätigung während der Behandlung,
zum Beispiel bei Kontakt mit der
Wange. So werden schmerzhafte
Berührungen für Patientinnen und
Patienten sowie Behandelnde ver-

mieden und die Patientensicherheit
ist bei gewohntem KaVo-Anwenderkomfort garantiert.
Die Kugellager, die in dentalen
Schnelllauf-Winkelstücken verbaut
werden, müssen extremen Geschwindigkeiten und Belastungen standhalten. Kugellager aus Keramik sind
nicht nur leichter und verschleißbeständiger, sondern bringen auch
noch Vorteile wie Korrosions- und
Temperaturwechselbeständigkeit
sowie eine geringere Reibung mit
sich. Bei den verwendeten exklusiven KaVo-Keramikkugellagern wurden zudem sowohl die Käfiggeometrie, als auch der Käﬁgwerkstoﬀ
optimiert – das alles trägt zu einer
längeren Lebensdauer bei.
Doch KaVo wäre nicht KaVo,
wenn nicht auch die EXPERTtorqueTurbinen weiter optimiert worden
wären. Diese stehen, wie alle KaVoInstrumente, nicht nur für Zuverlässigkeit und Qualität, sondern überzeugen schon immer mit ihrer Power –
und diese ist jetzt noch beeindruckender. So können die E680-Turbinen
mit einer maximalen Leistung von
circa 29 Watt aufwarten; die E677Miniturbinen erzielen eine Höchstleistung von circa 27 Watt (beide
Werte wurden bei 3,5 bar gemessen).
Um den Arbeitsalltag nicht nur
eﬀektiver zu gestalten, sondern auch
für eine ruhige und angenehme Arbeitsatmosphäre zu sorgen, ist es KaVo
gelungen, dank technischer Details
und Optimierungen, das Laufgeräusch
der EXPERTtorque-Turbinen um circa
2 dB(A) zu reduzieren. Dies entspricht
einer Geräuschreduzierung von ungefähr 26 Prozent.

Das funktioniert garantiert.
Mit KaVo
So überzeugende Qualität muss
gewürdigt werden – KaVo vertraut

auf seine Klassiker und gewährt
der gesamten EXPERT-Serie seit Ende
2022 eine verlängerte HerstellerStandardgarantie von 24 Monaten
statt der bisherigen 18 Monate.
KaVo not only develops new products and dental innovations but continually works to perfect its existing
range. Even products that have
proved their worth over many years
of real-world use undergo regular optimisation to improve performance,
safety and enjoyment in everyday
practice. The popular KaVo EXPERT series of instruments has now received
a KaVo “excellence update”. Since the
very outset, the series has been
known for its durability, eﬃciency
and intelligent, high-quality product
details. However, in order to meet
every practical requirement in rapidly changing times and to fulﬁl the
product promise in KaVo’s slogan
“Dental Excellence”, the dental turbines in the KaVo EXPERT series
have been further improved by including new features and technical
details.

A cool head, high-tech ball
bearings, more power and
less noise
KaVo EXPERTmatic E25 L and
E25 C dental turbines are some of
the most popular KaVo instruments.
Smart features, including the integration of KaVo CoolHead technology
and exclusive ball bearings, make
these best sellers safer, more robust
and more appealing. The CoolHead
technology actively prevents the instrument head from overheating if
the button is accidentally pressed
during treatment—for example, if it
comes into contact with the cheek. In
this way, painful contact can be prevented for both patients and treat-

ment specialists, and patient safety
can be guaranteed with the usual
level of KaVo user comfort.
The ball bearings installed in dental turbine contra-angles need to be
able to cope with extreme speeds and
loads. Ball bearings made from ceramic are not only lighter and more
resistant to wear but also bring beneﬁts such as resistance to corrosion
and ﬂuctuations in temperature as
well as lower friction. In addition, the
exclusive KaVo ceramic ball bearings
have optimised cage geometry and
cage material for a longer service life.
However, KaVo would not be
KaVo if the EXPERTtorque turbines
had not been further improved: Like
all KaVo instruments, these are
known for their reliability and quality, and they have also always impressed with their power—which is
now even more impressive. The E680
turbines have a maximum power of
approximately 29 W, and the E677
mini-turbines have a maximum power
of approximately 27 W (both measured
at 3.5 bar).

40th International Dental Show 2023 • 16. März 16 March

In order to improve the eﬀectiveness of everyday work while also
ensuring a quiet and pleasant working atmosphere, KaVo has succeeded
in reducing the operating noise of
EXPERTtorque turbines by approximately 2 dB(A), thanks to technical improvements. This corresponds to a
noise reduction of approximately 26%.

It’s guaranteed to work.
With KaVo
Such impressive quality needs to
be appreciated—KaVo has faith in
its classics and has been granting a
manufacturer’s standard warranty of
24 months on the whole EXPERT series since the end of 2022, six months
longer than the previous warranty of
18 months.

KaVo Dental, Germany
www.kavo.com
Hall 1.2
Booth A010/C019

[45] =>

HYDROSONIC
PRO

GENIAL
SANFT,
HÖCHST
WIRKSAM
MADE IN SWITZERLAND

BESUCHEN SIE UNS
AUF UNSEREM STAND
AUF DER IDS
HALLE 05.2.
STAND D-051

SWISS PREMIUM ORAL CARE

[46] =>

industry

BEISPIELLOSE DURCHZUGSKRAFT ERLEBEN
COME AND WITNESS UNPRECEDENTED POWER
Die Verwendung von
Keramik auf Zirkonoxidbasis
für Dentalanwendungen hat seit
Ende der 1990er-Jahre aufgrund
ihrer überlegenen mechanischen
Eigenschaften sowie ihrer Ästhetik zugenommen. Zirkonoxid-Prothesen sind in den
letzten Jahren sehr beliebt
geworden. Wenn sie jedoch
herausgenommen werden
müssen, ist es manchmal
schwierig, das Zirkonoxid
zu entfernen. NSK hat daher ein neues Turbineninstrument mit konkurrenzloser Leistung entwickelt. Die neue Turbine Ti-Max Z trägt die
Gene der Z-Serie in sich,
wurde aber weiterentwickelt, um unübertroffene Leistung und Funktionalität zu bieten.
Erleben Sie die phänomenale Durchzugskraft
der neuen Turbine, die
eine beispiellose Schneidkraft
bietet. Sie ist mit dem neuen Dynamic Power System ausgestattet, das
ein revolutionäres Schnittgefühl
bietet. Unter anderem die vergrößerte Auslassöﬀnung und die optimierte Düsenstruktur tragen dazu
bei, die höchste Rotationskraft in
dieser Klasse zu erreichen.
Ausgestattet mit dem neuen
Spannfutter DURAPOWER CHUCK
bietet die Turbine im Vergleich zu
herkömmlichen Modellen eine noch
stärkere Haltekraft, um das Risiko
eines Herausgleitens des Bohrers
zu verringern. Denn die von NSK
entwickelte Technologie verbessert
die Funktion des Spannfutters, weil
ein keilförmiger Teil den Bohrer
sicher festhält.
Erleben Sie phänomenale Durchzugskraft der Turbine am NSKStand.
Owing to their superior mechanical properties as well as their aes-

thetics, the use of zirconia-based ceramics
for dental applications increased since
the late 1990s. However,
when they need to be taken
out, many dentists struggle
to remove the zirconia. Therefore, NSK is now launching
a new air turbine with unrivaled power to meet the demands of clinicians. Inheriting
the DNA of the original Z series,
the new Ti-Max Z turbine has
evolved to feature unrivaled
power and functionality.
Experience the power of
the industry’s best-in-class handpiece as it delivers unprecedented cutting strength. It comes
equipped with a new Dynamic
Power System that provides a
revolutionary cutting feel. In
addition to the enlarged exhaust port, optimised nozzle
structure to achieve the highest rotational power in its ﬁeld.
Even time-consuming tasks like zirconia removal are made easy, reducing chair time and leaving patients at ease.
Equipped with a new DURAPOWER
CHUCK, it provides more sustained
gripping force to further reduce the
risk of a bur slipping, compared with
conventional models. NSK’s proprietary technology enhances the chuck
function. The wedge-shaped part
grips the bur ﬁrmly with force generated by the wedge eﬀect.
Experience unprecedented power
at the NSK booth.

NSK, Japan
www.nsk-dental.com
Hall 11.1
Booth A010/C019

SURESMILE FÜR EINE KLINISCH SICHERE UND GANZHEITLICHE
ALIGNER-BEHANDLUNG
SURESMILE ALIGNERS FOR A COMFORTABLE AND STREAMLINED
TREATMENT EXPERIENCE

1: Das SureSmile-Alignersystem ermöglicht exzellente Ergebnisse. 2: Der SureSmile-Retainer hält Zähne nach der Behandlung in Position.
1: The SureSmile clear aligner system allows for excellent results. 2: The SureSmile retainer keeps the teeth in position after treatment.

SureSmile ist eine kieferorthopädische Lösung von Dentsply Sirona,
die Zahnärztinnen und Zahnärzten
einen ganzheitlichen Behandlungsansatz für Patientinnen und Patienten bietet, die sich ein schönes, gesundes Lächeln wünschen. Da jede
Patientin und jeder Patient anders
ist, sind SureSmile-Aligner so konzipiert, dass Behandlerinnen und
Behandler eine erstklassige zahnmedizinische Versorgung für individuelle Bedürfnisse anbieten können.
SureSmile-Aligner werden mit
moderner Technologie und erprobten Materialien individuell angefertigt und bieten Patientinnen und Patienten vom ersten bis zum letzten
Aligner eine komfortable Passung.
SureSmile-Retainer halten die Zähne
in der gewünschten Position, sobald
die Behandlung abgeschlossen ist
und schützen so nachhaltig die Investition der Patientinnen und Patienten in ihr Lächeln. Die Retainer
sind langlebig und können den Kräften in der Mundhöhle widerstehen,
ohne ihre klinische Wirksamkeit zu
verlieren, auch wenn die Patientin
oder der Patient mit den Zähnen
knirscht (während einer kieferorthopädischen Behandlung und bei
vorschriftsmäßiger Anwendung).
Dentsply Sirona kann mit
SureSmile auf 20 Jahre Erfahrung
in der digitalen Planung kieferorthopädischer Behandlungen zurückblicken und kombiniert ein hervorra-

gendes Verständnis der Patientenbedürfnisse mit fortschrittlichen
Materialien und Technologien. Dies
schaﬀt Vertrauen in den Behandlungsprozess und sorgt für exzellente Ergebnisse. Die SureSmileAligner-Plattform ist kompatibel mit
allen Intraoralscannern von Dentsply
Sirona, einschließlich Primescan, sowie mit anderen gängigen Intraoralscannern. Investitionen in neue Geräte sind nicht nötig.
Als digitales System ist ein Ganzkieferscan der Startpunkt für die
Behandlung mit SureSmile-Alignern.
Wie dieser mit Primescan einfach
und schnell gelingt, kann direkt am
Dentsply Sirona-Stand ausprobiert
werden.
SureSmile is an orthodontic solution by Dentsply Sirona that oﬀers
dental professionals a comprehensive treatment approach for patients
wanting a beautiful, healthy smile.
Dentsply Sirona understands that
every patient’s journey is diﬀerent
and is dedicated to empowering dental professionals with clear aligner
tools and solutions in order to provide
patients with best-in-class dental
care using SureSmile.
SureSmile clear aligners are custom made using advanced technology
and proven materials, providing patients with a customised, comfortable
ﬁt from the ﬁrst aligner to the last.
SureSmile retainers protect patients’

investments in their smiles once
treatment is complete. They have the
strength to prevent teeth from being
damaged by bruxism without compromising the retainer’s clinical eﬀectiveness (when under orthodontic
treatment and used as prescribed).
By drawing on 20 years of experience in digital planning for orthodontic treatment, Dentsply Sirona
combines its unique understanding
of patients’ needs with SureSmile’s
advanced materials and technology.
The result is the provision of treatment plans with a high degree of predictability as well as a comfortable
and streamlined experience, culminating in results that give the patient
the conﬁdence boost that comes with
a straighter smile.
The SureSmile aligner platform
fully integrates with all Dentsply
Sirona scanners, including Primescan
and other commonly used intraoral
scanners, so no new equipment is required.
A full-arch scan is the starting
point for SureSmile aligner digital
treatment. How this works quickly
and easily with Primescan can be
discovered and tested at Dentsply
Sirona’s booth at IDS.
Dentsply Sirona, USA
www.dentsplysirona.com
Hall 11.2
Booth K010/K051

CHAIRSIDE RESTORATION PLUS MIT ORANGEDENTAL CHAIRSIDE RESTORATION PLUS WITH ORANGEDENTAL
Auf der IDS 2023 präsentiert orangedental
den oﬀenen Chairside-Workﬂow für professionelle Praxislabore. Unter dem Motto „Chairside Restoration plus“ können Besucherinnen
und Besucher eine Alternative zu bestehenden Systemen für die Nass- oder Trockenbear-

1: FUSSEN intra-oral scanner. 2: EVO deskMill5 Pro.

beitung von Blöcken und Ronden erleben. Einfach gesagt: Mit dem intraoralen Scannen mit
dem FUSSEN-Scanner, dem Design mit exocad
ChairsideCAD und der Fertigung mit Dentalfräsmaschinen der EVO deskMill- Serie können Zahnärztinnen und Zahnärzte mehr als

nur Kronen oder Inlays fräsen. Im Röntgenbereich wird mit dem Green 2 eine professionelle
DVT-Einheit der Extraklasse mit Field of View
bis zu 10 × 8 cm für Einsteiger vorgestellt. Das
bekannte Panoramaröntgengerät PaX-i ﬁndet
mit dem PaX-i Plus einen Nachfolger in neuem
Design. Das EzRay AIR W2 ist ein neues Intraoral-Röntgengerät mit Bluetooth-Übertragung
der Aufnahmeparameter. Die digitale Funktionsanalyse mit dem neu entwickelten, digitalen Freecorder Nxt und Schnittstelle zum
exocad Jaw Motion Import-Modul ermöglichen
passgenaue Endprodukte unter Berücksichtigung der dynamischen Okklusion. Besuchen
Sie den Stand des Unternehmens, um mehr zu
erfahren.
At IDS 2023, orangedental is presenting its
open chairside workﬂow for professional practice laboratories. Under the slogan “Chairside
Restoration plus”, visitors can experience
the company’s alternatives to existing systems
for the wet or dry processing of blocks and
discs. Simply put, with intra-oral scanning using the FUSSEN scanner, design with exocad

40th International Dental Show 2023 • 16. März 16 March

ChairsideCAD and production with dental milling machines from the EVO deskMill series,
dental professionals can create more than just
mill crowns or inlays.
Also on show at IDS will be the company’s
innovations in the ﬁeld of radiography. Among
these is the Green 2, a ﬁrst-class professional
entry-level CBCT unit with a ﬁeld of view of up
to 10 × 8 cm. The well-known PaX-i dental panoramic tomogram machine has found a successor
in the PaX-i Plus, which features a new design.
The EzRay AIR W2 is a new intra-oral radiography device that supports Bluetooth transmission of the acquisition parameters. The digital
functional analysis that is oﬀered by the newly
developed digital Freecorder Nxt and its interface with the exocad Jaw Motion Import module
enable dental professionals to create tailor-made
products that account for dynamic occlusion.
Visit the company’s booth to ﬁnd out more.
orangedental, Germany
www.orangedental.de
Hall 11.2, Booth L020/N029

[47] =>

industry

DIGITALE ABFORMUNG LEICHT GEMACHT MIT
DEM VIVASCAN VON IVOCLAR
DIGITAL IMPRESSION TAKING MADE EASY WITH
NEW VIVASCAN INTRA-ORAL SCANNER FROM
IVOCLAR
Um einen erfolgreichen Start
mit dem VivaScan zu ermöglichen,
bietet Ivoclar ihren Partnern eine
umfassende Unterstützung in Form
von Live-Demos in der eigenen Praxisumgebung, Schulungen und individueller Beratung bei der Integration an.
Den VivaScan und weitere Produktinnovationen von Ivoclar ﬁnden
Sie am Stand der Firma auf der
IDS.

Mit dem VivaScan hat Ivoclar
einen kompakten, leistungsstarken
und intuitiven Intraoralscanner
für Zahnärztinnen und Zahnärzte
im Programm, die in die Welt der
Digitalen Zahnheilkunde einsteigen
möchten. Dank seines schlanken
Designs lässt sich das Gerät einfach und mühelos in den Praxisalltag integrieren, liefert hervorragende
Scanergebnisse und ermöglicht einen eﬃ zienteren Arbeitsablauf.
Mit einem Intraoralscanner können Zahnärztinnen und Zahnärzte
schnell, einfach und mühelos digitale Abdrücke von den Zähnen ihrer Patientinnen und Patienten erstellen. Im Vergleich zur konventionellen Abdrucknahme ist die digitale Abformung deutlich zeitsparender und angenehmer für die
Patientinnen und Patienten.
Die innovative Laserscan-Technologie des VivaScan liefert präzise
Ergebnisse, um den Patientinnen
und Patienten hervorragend passende Restaurationen anzubieten.
Sein schlankes und ergonomisches
Design macht das Scannen zu einer
mühelosen Aufgabe. Mit einem Gewicht von nur rund 230 g lässt sich
der VivaScan sehr ﬂexibel einsetzen. Dank der Plug-and-play-Funktion des Geräts kann die Behandlerin oder der Behandler direkt mit
dem Scannen anfangen, ohne vorher
Patientendaten eingeben zu müssen. Der Scanner muss dazu lediglich über ein einziges Kabel an einen Laptop angeschlossen werden.
Der VivaScan wird mit zwei unterschiedlich großen Aufsätzen geliefert, um jeweils die beste Passform
für die einzelne Patientin oder den
einzelnen Patienten zu bestimmen.
Die hohe Geschwindigkeit des neuen
VivaScan ermöglicht ein schnelles,
eﬃzientes Scannen und hilft, mehr
Patientinnen und Patienten in der
gleichen Zeit zu behandeln.
Mit der benutzerfreundlichen
und intuitiven Software können die
Scans in einem optimierten Arbeitsablauf direkt an das Labor der Wahl
gesendet werden. Die integrierte
Filesharing-Lösung, die keine zusätzlichen Kosten verursacht, sorgt
für eine sichere Datenübertragung
mit nur einem Klick in die IvoclarCloud, aus der sich die Zahntechnikerinnen und Zahntechniker die
Daten dann ebenso einfach in einem oﬀenen Format herunterladen
können.

With VivaScan, Ivoclar oﬀers a
compact, powerful and intuitive intraoral scanner for dentists who want
to access the beneﬁts of digital dentistry. Given its sleek design, the
scanner integrates easily and eﬀortlessly into routine clinical workﬂows,
and it also produces exceptional scanning results and increases workﬂow
eﬃciency.
Intra-oral scanners enable dentists to take digital impressions of
their patients’ teeth easily and eﬀortlessly. Compared with conventional
techniques, digital impression taking saves time and improves patient
comfort.
VivaScan’s innovative laser scanning technology delivers precise scanning results, which help to provide
patients with superbly ﬁtting restorations. The scanner’s slim and ergonomic design makes scanning itself
an easy and comfortable task, and—
given its light weight of just 230 g—
the VivaScan can be ﬂexibly integrated into any workﬂow in the dental
practice. The scanner’s plug-and-play
function enables the operator to start
scanning right away without having
to enter any patient data ﬁrst. The
scanner only needs to be connected
to a laptop via a single cable, and it
is ready for scanning. The VivaScan
is supplied with two diﬀerently sized
tips to match the individual needs of
the patient. The high speed of the
new VivaScan enables fast, eﬃcient
scanning and allows dentists to treat
more patients in the same amount of
time.
Using the user-friendly and intuitive software, scans can be sent directly to the laboratory of choice in
an optimised workﬂow. The integrated
ﬁle-sharing solution provides the secure transfer of data at no additional
cost. With just one click, the scans are
uploaded to the Ivoclar Cloud and
can be easily downloaded in an open
ﬁle format by the dental technician.
In order to help customers to
make a successful start with the
VivaScan, Ivoclar oﬀers its partners
a comprehensive package of support,
which includes live demonstrations,
training sessions and one-on-one consultations. Experience VivaScan and
other Ivoclar product innovations by
visiting the company at IDS 2023.
Ivoclar, Liechtenstein
www.ivoclar.com
Hall 11.3
Booth A010/C029,
A011, A020/C029

HOCHFESTE LITHIUMDISILIKAT-GLASKERAMIK MIT NEUER HIGH-DENSITY
INTERLOCKING-TECHNOLOGIE
HIGH-STRENGTH LITHIUM DISILICATE GLASS CERAMIC WITH NEW
HIGH-DENSITY INTERLOCKING TECHNOLOGY
Vintage Prime Press ist die neue hochfeste Lithiumdisilikat-Glaskeramik für die Herstellung von Kronen,
Inlays, Onlays, Veneers und 3-gliedrigen Frontzahnbrücken mit hervorragender Ästhetik. Die exzellenten Festigkeitswerte von bis zu 525 MPa verdankt Vintage
Prime Press einem neuen Verfahren mit einer verlinkten Kristallstruktur innerhalb der Glasmatrix. Diese
Verzahnung unterdrückt die Rissübertragung und verbessert die Beständigkeit gegen Abplatzungen.
Die Vorteile sind vielfältig:
• Hohe biaxiale Biegefestigkeit
• Verlässliche Farbstabilität auch nach wiederholtem
Brennen
• Exakte Passungen durch fast keine Reaktionsschicht
nach dem Pressen
• Abriebfest und sanft zum Antagonisten
Es sind vier verschiedene Transluzenstufen verfügbar:
• Enamel (E) – Hohe Lichtdurchlässigkeit, entspricht
dem Zahnschmelz
• High Translucency (HT) – Moderate Transluzenz für
Kronen und Brücken
• Low Translucency (LT) – Geringe Transluzenz bei
leicht verfärbten Präparationen
• High Opacity (HO) – Hohe Opazität zum Kaschieren
von Abutments und Gerüsten
Diese können mit Vintage LD-Schichtkeramik und
Vintage Art Universal-Malfarben kombiniert werden.
Vintage Prime Press bietet für alle Arten von metallfreien Restaurationen die richtige Farb- und Transluzenzabstimmung von hoch transluzent für Veneers bis
hoch opaque zum Kaschieren verfärbter Zähne oder
Abutments.
Vintage Prime Press is the new high-strength lithium
disilicate glass ceramic to produce outstandingly aesthetic
crowns, inlays, onlays, veneers and three-unit anterior
bridges. A new process, creating an interlocked crystal
structure in the glass matrix, gives Vintage Prime Press
excellent strength values of up to 525 MPa. This structure
counteracts crack propagation and improves chipping resistance.

The beneﬁts are numerous:
• high biaxial ﬂexural strength
• reliable colour stability even after repeated ﬁring
• precise ﬁts due to almost no reaction layer after pressing
• abrasion-resistant and gentle to antagonists
Four diﬀerent translucency levels are available:
• E = enamel-like light transmission
• HT = high to moderate translucency for crowns and
bridges
• LT = low translucency for slightly discoloured preparations
• HO = High opacity for masking abutments and frameworks
It is possible to combine them with Vintage LD layered ceramics and Vintage Art Universal stains.
Vintage Prime Press oﬀers the right shades and translucencies for all types of metal-free restorations, ranging
from highly translucent for veneers to highly opaque for
masking discoloured teeth or abutments.

SHOFU DENTAL, Germany
www.shofu.de
Hall 11.3, Booth C010/E019

OSSTEM IMPLANT STREBT FÜHRENDE POSITION AUF DEM GLOBALEN
DENTAL- UND MEDIZINGERÄTE-MARKT AN
OSSTEM IMPLANT AIMS TO LEAD THE GLOBAL DENTAL AND MEDICAL
EQUIPMENT MARKET
OSSTEM IMPLANT hat vor Kurzem einen Absatz von
40.000 K3-Behandlungsstühlen verzeichnet. Die K3und K5-Stuhleinheiten, die mit einem leistungsstarken
Handstück, Scaler und SNAP-Intraoralscanner ausgestattet sind, zeichnen sich durch eine hervorragende
Funktionalität aus. Dank des stabilen Drehmoments und
der exzellenten Motorleistung können Zahnärztinnen
und Zahnärzte das Schneiden leicht kontrollieren und
feine Präparationen und präzise Ränder durchführen.
K5 verfügt über eine Sitzkippfunktion, die Patientinnen
und Patienten in einer stabilen Behandlungsposition
hält, wenn die Rückenlehne nach hinten geneigt ist. Außerdem bietet die Einheit einen kabellosen Fußanlasser
und eine Sterilisationsvorrichtung für die Wasserversorgung für eine optimale Behandlungsumgebung.
Die T2-Unit von OSSTEM ist ein 3-in-1-Bildgebungsgerät, welches CBCT-, CT-, Panorama- und Cephalometric
Imaging in einem einzigen System integriert. OSSTEM
hat eine Funktion zur Reduzierung von Metallartefakten
in die T2 integriert, um die Schärfe der Bilder deutlich
zu verbessern. Die Firma erhielt im September 2022 die
Marktzulassung der U.S. Food and Drug Administration
für die T2-Unit.
OSSTEM IMPLANT recently recorded sales of 40,000 of
its K3 dental chair units. The K3 and K5 dental chair
units, equipped with a high-performance handpiece,
scaler and SNAP intra-oral scanner, boast outstanding functionality. Also, thanks to the
stable torque and excellent power of the mo-

tor, clinicians can easily control cutting and perform ﬁne
preparations and precise margins. The K5 has a seat-tilting function that keeps the patient in a stable treatment
position when the back-rest is reclined, a wireless foot
controller and a water supply sterilising device, delivering
an optimal treatment environment for dentists.
OSSTEM’s T2 is a three-in-one imaging device that integrates CBCT, CT, and panoramic and cephalometric imaging into a single system. OSSTEM incorporated a metal
artefact reduction function in the T2 to signiﬁcantly improve the sharpness of the images. OSSTEM obtained
U.S. Food and Drug Administration market clearance for
the T2 unit in September 2022.
OSSTEM IMPLANT, South Korea
en.osstem.com
Hall 1.2, Booth A030/C039

[48] =>

[49] =>

Smart. What you see is what you get.
Schnell. Alles in einem Brand.

Realisation & Photo © Christian Ferrari

Ästhetisch. Natürliche Transluzenz,
Opaleszenz und Fluoreszenz.

t
s
r
i
f
y
m amic
r
ce aste
p
in
die
t
s
i
m.
h
r
c
o
u
f
e To
sten
a
® On
P
in
nd
k
i
ion
u
t
m
o
a
D
r
M
tik
2
e
e
k
e
h
d
t
t
l
cera
n
s
Ä
icke
e
rble
ß
e
w
i
t
V
e
n
dw
aus
n
erste peziell e
u
n
e
e
rot
ds
tion
a
n
e
i
i
r
s
d
u
Es
sta
für
e
n
R
e
ast
xid.
hen
P
c
o
s
n
i
D
3
irko
ram
Z
e
k
l
d
l
un
vo
t
n
a
o
k
i
v
isil
D
um
Lithi
nY

ne
atio

Me

rm
o
f
n
hr I

Live Demos mit Top Referenten
am Dentaurum Stand.
Halle 10.1 Stand D010 / E019

Turnstr. 31 I 75228 Ispringen I Germany I Telefon + 49 72 31 / 803 - 0 I Fax + 49 72 31 / 803 - 295
www.dentaurum.com I info@dentaurum.com

[50] =>

industry

NEUE ZAHNMEDIZINISCHE BILDGEBUNGSTECHNOLOGIE BRINGT PATIENTENVERSORGUNG IN NEUE DIMENSIONEN
NEW DENTAL IMAGING TECHNOLOGY TAKES PATIENT CARE TO A NEW LEVEL
Das japanische Unternehmen
PreXion ist einer der führenden Anbieter dentaler 3D-Bildgebungstechnologie und stolz, sein brandneues
Produkt, den PreXion3D EXPLORER
PRO, auf den europäischen Markt
zu bringen. Dieses High-End-DVTSystem ist ein Novum in der zahnmedizinischen Bildgebung, denn es
kombiniert 3D-DVT-Aufnahmen mit
Volumen von 5 × 5 cm bis 15 × 16 cm,
einen speziellen OPG-Modus und
One-Shot-CEPH-Aufnahmen ohne
FRS-Auslegerarm. Der PreXion3D
EXPLORER PRO bietet ein breites
Spektrum an klinischen Anwendungen, von der endodontologischen
Behandlung über die MKG- Chirurgie bis hin zu Atemwegsanalysen.
Einer der wichtigsten Vorteile
des PreXion3D EXPLORER PRO ist
seine fortschrittliche Technologie,
die das weltweit erste im Gerätekopf integrierte kephalometrische
Röntgenbild liefert. Diese innovative Technologie ermöglicht es dem
Gerätekopf, sich automatisch um
45 Grad zu drehen und um 30 cm zu
öﬀnen, um kephalometrische Röntgenbilder als One-Shot aufzunehmen.
Der PreXion3D EXPLORER PRO ist
eine kosteneﬀektive Lösung für
Zahnarztpraxen, denn durch die innovative Technologie kann auf einen zusätzlichen FRS-Auslegerarm

verzichtet werden. Dieses kompakte
Design spart Platz und ermöglicht
eine einfache Installation in jeder
Zahnarztpraxis.
Der PreXion3D EXPLORER PRO
verfügt auch über einen hochwertigen Flachbildsensor und einen Brennpunkt, der mit 0,3 × 0,3 mm zu den
kleinsten gehört, dadurch wird eine
präzise 3D-Bildgebung ermöglicht.
Die Kombination aus gepulster Strahlung und hoher Spannung gewährleistet eine geringe Strahlendosis

für Patientinnen und Patienten, und
macht das Gerät zu einer sicheren
und zuverlässigen Wahl.
Der PreXion3D EXPLORER PRO
ist ein High-End-DVT-System, das
fortschrittliche Technologie, Präzision,
Geschwindigkeit und Sicherheit in
der zahnmedizinischen Bildgebung
bietet. Zahnärztinnen und Zahnärzte
können ihren Patientinnen und Patienten jetzt eine umfassende und
eﬃziente Lösung für ihre diagnostischen Bedürfnisse anbieten.
The Japanese company PreXion,
one of the leading providers of dental
imaging technology, has launched
PreXion3D EXPLORER PRO, a highend CBCT system that is part of
the PreXion 3D EXPLORER series
is a gamechanger in the dental
imaging market, combining largeﬁeld CT from 5×5cm to 15×16cm,
dedicated panoramic mode, and oneshot cephalometric imaging without a ceph arm. The PreXion3D
EXPLORER PRO oﬀers a wide range
of clinical applications, from endodontic treatment to maxillofacial surgery and airway analysis.
One of the most signiﬁcant advantages of the PreXion3D EXPLORER
PRO is its advanced technology that
delivers the world’s ﬁrst gantry-integrated cephalometric radiograph with
innovative built-in ceph arm design.

Therefore, the CBCT is able to automatically shift 45 degrees and open
by 30 cm to capture cephalometric
adiographs.

The PreXion3D EXPLORER PRO
eliminates the need to purchase an
additional ceph arm, making it a
cost-eﬀective solution for dental practices. Its compact design saves space
and allows for easy installation in
any dental oﬃce.
The PreXion3D EXPLORER PRO
also features a high-quality panel and
a focal spot that is among the least
sizeable in the industry at only
0.3 x 0.3 mm, allowing for precise 3D
imaging. The combination of pulsed
irradiation and high voltage ensures
low radiation doses, making it a safe
and reliable option for patients.

The PreXion3D EXPLORER PRO
is a high-end CBCT system that oﬀers
advanced technology, precision, speed
and safety in dental imaging. Dental

professionals can now oﬀer their patients a comprehensive and eﬃcient
solution for their diagnostic needs.

PreXion Europe,
Germany
www.prexion.eu
Hall 11.1
Booth A058/B059

METASYS IDS NOVELTIES
)$ ! $! $ $Ĺ
$!" "!$ "+$ ( $

$$ &

" !$Ĺ
$ $ !"

" !$!)$$

$&$

"&$"+"$ "Ĺ
!(

! $$ !"&$ &")! Ƒ!ƒ"&$$!"

! +Ĺ
) $ ! + )"$

IDS 2O23 | ƐƓĺƏƒĺ҄ƐѶĺƏƒĺƑƏƑƒ|
ƐƏĺƑĺ" !ĺƏƓƐ
th
40

International Dental Show 2023 • 16. März 16 March

$ƳƓƒƔƐƑƑƏƔƓƑƏŇbm=oŠl;|-vvĺ1olŇl;|-vvĺ1ol

[51] =>

industry

NEUE 3D-DRUCKTECHNOLOGIE UND HOCHWERTIGE MATERIALIEN VON DESKTOP HEALTH
NEW 3D-PRINTING TECHNOLOGY AND PREMIUM MATERIALS FROM DESKTOP HEALTH
Falls Sie die Neuigkeit verpasst

haben: EnvisionTEC, Pionier der DLPDrucktechnologie, heißt jetzt Desktop Health. Mit mehr als 20 Jahren
Erfahrung im deutschen Maschinenbau bietet Desktop Health hochwertige 3D-Drucklösungen für die
Zahnmedizin, welche eine individuelle Patientenversorgung mit präziser Passform und Verarbeitung ermöglichen.
Desktop Health hat kürzlich
eine innovative neue Drucktechnologie und hochwertige Materialien auf den Markt gebracht. Wir
laden Sie ein, unseren Stand auf
der IDS zu besuchen, um mehr
über die Vorteile unserer Lösungen für Ihr Unternehmen zu erfahren.
Die Produkte von Desktop
Health, wie der neue Einstein Pro XL
Hochpräzisions-DLP-Drucker, der
für maximale Produktivität ausgelegt wurde und dessen Fokus auf
Geschwindigkeit liegt, sind perfekt
auf die Bedürfnisse von zahnmedizinischen Teams zugeschnitten
und erfüllen die wichtigsten Anforderungen des 3D-Drucks im Dentalbereich. Darüber hinaus ermöglichen die hochwertigen biokompatiblen Materialien und Modellmaterialien des Unternehmens

höchste Genauigkeit, Durchsatz und
Vielseitigkeit.
Die neuen SmileGuard Aufbissschienen aus Kunststoﬀ bieten die
perfekte Mischung aus Festigkeit
und Komfort zum Schutz des Lächelns Ihrer Patienten. Der FlexceraZahnersatz bietet keramikähnliche
Festigkeit und Ästhetik mit einer
dreifach höheren Bruchdehnung
für Langlebigkeit, und einer doppelt so hohen Beständigkeit gegen
Feuchtigkeit im Vergleich zu führenden Wettbewerbern. Die Materialien des Modells X bieten eine
überragende Präzision für Kronen
und Brücken, und das Modell Z ermöglicht die schnelle Herstellung
von kieferorthopädischen Vollbögen.
Erfahren Sie mehr über unsere
fortschrittlichen Dentalmaterialien
und erleben Sie unsere außergewöhnlichen Endergebnisse sowie die
vier einfachen Schritte des digitalen
3D-Druck-Workﬂows und die perfekte Passform, die Desktop HealthLösungen Ihrem Unternehmen bieten können.
Unsere Experten für den dentalen 3D-Druck stehen Ihnen während der gesamten Messe zur Verfügung, um die richtigen Lösungen für
Sie zu ﬁnden. Gemeinsam können

wir Ihr Unternehmen in ein produktives, zuverlässiges und kosteneﬃzientes Geschäft verwandeln.
In case you missed the news:
EnvisionTEC, the pioneer in digital
light-processing (DLP) technology,
has undergone a transformation and
is now known as Desktop Health. With
over 20 years of German engineering
experience, Desktop Health oﬀers
high-quality and aﬀordable dental
3D-printing solutions that deliver
personalised patient care with a precision ﬁt and ﬁnish.
Desktop Health has recently
launched an innovative new printing
technology and premium materials.
We invite you to visit our booth at IDS
to learn more about the beneﬁts of
our solutions for your business.
Perfectly designed for dental professionals to meet the most crucial
needs in dental 3D printing, Desktop
Health products, such as the new
Einstein Pro XL high-precision DLP
printer, which was built for production-grade performance and speed. In
addition, the company’s premium biocompatible model materials allow for
highest accuracy, throughput and
versatility.
The new SmileGuard resin bite
splints oﬀer the perfect blend of

strength and comfort to protect your
patient smiles. Flexcera dentures offer ceramic-like strength and beauty
with three times the fracture rate for
durability and two times the resistance to moisture compared to leading
competitors. Model X materials deliver superior accuracy for crown and
bridges, and Model Z delivers speed
for producing orthodontic full arches.
Learn about our advanced dental
resins and experience our exceptional end results as well as the four
easy steps of digital 3D-printing workﬂow and the perfect ﬁt Desktop

Health solutions can provide your organisation.
Our dental 3D-printing experts
are available throughout the exhibition to help you identify the right
solutions for your business needs. Together we can transform your business into a productive, reliable and
cost-eﬃcient work environment.

Desktop Health, USA
health.desktopmetal.com
Hall 4.1, Booth D070

ZOLID BION: RAFFINIERTE VERBINDUNG VON ÄSTHETIK, SICHERHEIT UND GESCHWINDIGKEIT
ZOLID BION: INGENIOUS COMBINATION OF AESTHETICS, SAFETY AND SPEED
Mit Zolid Bion hat Amann Girrbach
die nächste Evolutionsstufe an vollkeramischen Materialien aus Zirkonoxid erreicht. Zolid Bion basiert
auf 15 Jahren Zirkonoxid-Entwicklungsarbeit und ist sehr vielseitig.
„Zirkonoxid ist der CAD/CAM-Werkstoﬀ schlechthin. Seit knapp zwei
Jahren erscheinen vermehrt sogenannte 3D-Zirkonoxide am Markt,
die vor allem hinsichtlich der Ästhetik im Bereich der Schneide zahlreiche Vorteile mit sich bringen. Bislang mussten dafür aber oft Kompromisse zugunsten der Sicherheit
eingegangen werden. Zolid Bion
vereint Ästhetik und Sicherheit,
ganz ohne Kompromisse und bietet einen optimalen Workﬂow“, so
Melanie Röschmann, Director Global Business Unit Consumables bei
Amann Girrbach.
Zolid Bion punktet durch einen
stufenlosen Farbverlauf und eine erhöhte Transluzenz im Schneidebereich. Für noch mehr Vielfalt und Efﬁzienz in der Verarbeitung ist Zolid
Bion zudem in 16 VITA-Farben und
in zunächst zwei Bleach-Varianten
sowie in unterschiedlichen Rohlingshöhen verfügbar.
Die Kombination von Ästhetik
und Sicherheit liegt in den von
Amann Girrbach eingesetzten innovativen Rohstoﬀen begründet und
gewährleisten eine Festigkeit von
über 1.100 ± 150 MPa über den gesamten Rohlingsquerschnitt. „In der
Planung und Anwendung bedeutet
das volle Freiheit und Sicherheit. Anwender müssen sich nicht mehr zwischen verschiedenen Materialien

entscheiden, sondern können mit
Zolid Bion ein breites Indikationsspektrum bedienen“, erklärt Röschmann und ergänzt: „Zusätzliche Sicherheit bringt auch der neue Kunststoﬀrahmen, der ab sofort im gesamten Zolid-Portfolio zu ﬁnden ist.
Durch ihn können unschöne Abplatzer und Brüche vermieden und
für ein sicheres Handling in allen
Frässystemen gesorgt werden.“

translucency in the incisal area. For
even more diversity and eﬃciency
in processing, it is also available in
16 VITA shades and in two bleach
variants, as well as in diﬀerent blank
heights.
The combination of aesthetics
and safety is attributable to the raw
materials used, ensuring a strength
of over 1,100 ± 150 MPa over the entire cross section of the blank. According to Röschmann, “This means
absolute freedom and safety, and users no longer need to choose between
diﬀerent materials.” She added: “Additional safety is also provided by the
new acrylic frame, which is now featured throughout the entire Zolid
portfolio. This can prevent unsightly
chipping and fractures and ensures
safe handling in all milling systems.”

Kronen aus Zolid Bion in
nur 45 Minuten sintern
Amann Girrbach entwickelt und
baut auch selbst Sinteröfen für Zirkonoxid- und Sintermetall-Restaurationen. Das neueste Produkt aus diesem Bereich ist der Highspeed-Ofen
Ceramill Therm DRS, der Röschmann zufoldge das Sintern in nur
45 Minuten ermöglicht. „Zolid Bion ist
das erste Material seiner Klasse, mit
dem eine solche Geschwindigkeit erreicht werden kann“, so Röschmann.
Besuchen Sie den Stand von
Amann Grirrbach auf der IDS und
erfahren Sie mehr über Zolid Bion.
Amann Girrbach bietet außerdem
ein täglich wechselndes Vortragsprogamm an seinem Stand an.
With Zolid Bion, Amann Girrbach
has advanced to the next evolutionary stage in all-ceramic materials made of zirconia. Zolid Bion is
based on 15 years of zirconia development work and is highly versatile. Melanie Röschmann, director of the company’s consumables
business unit, explained: “Zirconia
is the CAD/CAM material par ex-

Zolid Bion.

Sintering of Zolid Bion
crowns in just 45 minutes

Arbeit mit Zolid Bion von Zahntechnikermeister Benjamin Votteler
Zolid Bion work by master dental technician Benjamin Votteler.

cellence. So-called 3D zirconia materials have been appearing on the
market and have numerous advantages, particularly with regard to
aesthetics in the area of the incisal
edge. However, until now, compromises have been necessary in the in-

terests of safety. The innovative
Zolid Bion perfectly combines aesthetics and safety without making
any compromises and provides an
optimal workﬂow.”
Zolid Bion zirconia boasts a
smooth colour gradient and increased

Amann Girrbach also develops
and builds its own sintering furnaces
for zirconia and sintered metal restorations. The latest is the Ceramill
Therm DRS high-speed furnace, which
Röschmann says can sinter Zolid Bion
crowns in just 45 minutes. “Zolid Bion
is the ﬁrst material in its class to
achieve such speeds,” she said.
Visit Amann Girrbach’s booth at
IDS. Amann Girrbach also oﬀers daily
lectures events at its booth.
Amann Girrbach, Austria
www.amanngirrbach.com/ids
Hall 1.2
Booth C040/D041

40th International Dental Show 2023 • 16. März 16 March

[52] =>

industry

GC PRÄSENTIERT NEUEN AADVA LAB SCAN 3, DER WELTWEIT ERSTE KI-BASIERTE UND GESTENGESTEUERTE DENTALLABORSCANNER
GC INTRODUCES NEW AADVA LAB SCAN 3, THE WORLD’S FIRST AI-BASED AND GESTURE-CONTROLLED DENTAL LAB SCANNER
Beim Dentalhersteller GC steht
Digitalisierung ganz oben auf der
Agenda. Das zeigt die nächste Generation von Laborscannern, die
GC nun auf den Markt bringt: den
Aadva Lab Scan 3. Mit seiner einzigartigen Objekterkennung, die
auf künstlicher Intelligenz (KI) basiert, identiﬁziert der Scanner das
eingelegte Objekt und nimmt automatisch die notwendigen Anpassungen für einen optimalen Scan
vor. Anwenderinnen und Anwender
müssen dabei nicht eingreifen, sondern werden dank automatisierter,
durch KI gesteuerte Arbeitsabläufe
entlastet und können sich auf höchste
Genauigkeit beim Scannen verlassen.
Der Aadva Lab Scan 3 verwendet eine patentierte Projektionsmethode, bei der Ergebnisse ausgewertet und Prozesse ständig optimiert
werden, die das Gerät steuern. Das
führt zu einem zeitsparenden und
fehlerfreien Scanﬂow.
Neben diesen besonderen Merkmalen verfügt der Scanner über zwei
hochauﬂösende Kameras und einen
fortschrittlichen 3D-Sensor. Sie tragen zu einer optimalen Datenerfassung und einer sehr hohen Genauigkeit mit einer Abweichung von
weniger als 4 μm (gemäß ISO 12836)
bei. Hinzu kommt eine extrem
schnelle Scanzeit von 12 Sekun-

den für ein komplettes Modell (gemessen bei deaktiviertem Farbscan).
Der Aadva Lab Scan 3 wird mit umfangreichem Standardzubehör geliefert.
Alle Dentalfachleute sind eingeladen, die Vorteile der Arbeitsabläufe und Lösungen von GC in
Hands-on-Kursen und bei Labordemonstrationen direkt zu erleben –
auf der IDS am Messestand. Dort referieren täglich international renommierte Zahnärzte und Zahntechniker
in der Speakers’ Corner zu aktuellen
Themen.

Continuing its strive for digitalisation, GC has released its next generation lab scanners: Aadva Lab
Scan 3. With its unique object recognition, which is based on articﬁcial intelligence (AI) technology, the
scanner identiﬁes the inserted objects and automatically makes the
necessary adjustments for an optimal scan without any user intervention. These automated, AI-controlled
workﬂows provide peace of mind.
Aadva Lab Scan 3 uses a patented
projection, constantly optimising processes that control the device, which

results in time eﬃcency and an errorfree workﬂow.
In addition to these unique features, the scanner oﬀers two high-resolution cameras and an advanced 3D
sensor contributing to optimal data
acquisition for very high accuracy of
4 μm (ISO 12836) and an extremely
fast scan time of 12 seconds for a
full arch (measured with deactivated
colour scanning). Aadva Lab Scan 3
comes with a wide range of standard
accessories.
All dental professionals are invited to experience the beneﬁts of

the new GC’s workﬂows and solutions at the booth during hands-on
courses and lab demos. Additional
booth experience will include internationally renowned dentists and
technicians daily presenting on current topics of interest on the booth at
the speakers’ corner.

GC Europe, Belgium
www.gc.dental/europe
Hall 11.2
Booth N010/O039

HurriView® and HurriView II® highlight where improved oral hygiene is needed

Available in 1 fl. oz. bottles of liquid, 1 oz. bottles of gel and
individually wrapped unit dose Snap -n- Go™ Swabs

20% Benzocaine for fast, temporary relief of
occasional minor irritation and pain associated with:

• HurriView highlights plaque in reddish-pink
• HurriView II highlights old plaque in blue and
new plaque in reddish-pink
• Helps you show patients where they have
plaque build-up & helps motivate them to
improve their oral hygiene routines
• Individually wrapped
• In-office evaluation or dispense for home use
• Available in boxes of 72
• No messy rinses or tablets!

• Sore mouth and throat
• Canker sores
• Minor dental procedures
• Minor injury of the mouth and gums
• Minor irritation of the mouth and gums caused by
dentures or orthodontic appliances
EFFECTIVE
• Trusted by dental professionals for over 40 years
• Eliminates pain and discomfort
FAST-ACTING
• Relief within 30 seconds
SAFE
• Virtually no systemic absorption
• Available over the counter

40th International Dental Show 2023 • 16. März 16 March

FAST-ACTING
Chairside results
TREATS SENSITIVITY
When used for cervical sensitivity,
HurriSeal® will last for 6 to 9 months
PREVENTS SENSITIVITY
When applied under restorations, HurriSeal
lasts for the lifetime of the restoration
EASY TO USE
No mixing or light-curing
SOFT TISSUE FRIENDLY
Gentle to soft tissue and does not cause
gingival irritation when used as directed

[53] =>

[54] =>

industry

3DISC ERFINDET INTRAORALEN SCANNER MIT OVO NEU
3DISC REINVENTS THE INTRA-ORAL SCANNER WITH OVO
Nach der Einführung des Intraoralscanner HERON IOS der bereits
2022 von Zahnärztinnen und Zahnärzten zum zweitbeliebtesten Intraoralscanner gewählt wurde, erweitert 3DISC nun sein Produktportfolio durch die Markteinführung
von OVO, ein Produkt, das den Intraoralscanner neu erﬁndet.
Seit dem Einzug der Digitalisierung in die Zahnarztpraxis sind Intraoralscanner die wichtigste digitale Innovation der letzten zehn
Jahre. Dank der gesteigerten Präzision, der Geschwindigkeit der Bilderfassung und der Möglichkeit, Zahnabdrücke mit nur wenigen Klicks
an Dentallabore zu senden, bietet
diese Technologie Zahnärztinnen
und Zahnärzten sowie ihren Patientinnen und Patienten einen echten Mehrwert.
OVO ist eine technologische Revolution sowohl in Bezug auf die
Hardware als auch auf die Software,
dank der integrierten 2D-Kamera
und der Scan&Tell-Kommunikationssoftware mit Smile Design und Buccal Monitoring.
OVO ist ein klinisches Kommunikationstool, das es Zahnärztinnen
und Zahnärzten ermöglicht, gemeinsam mit ihren Patientinnen und Patienten deren Gebiss und die möglichen Behandlungsempfehlungen zu

Marie-Laure Pochon, Geschäftsführerin von 3DISC, kommentiert:
„OVO ist eine große Bereicherung
für 3DISC. Wir sind damit anderen
Scannern einen Schritt voraus. Wir
bieten den Patienten einen neuen
Komfort und optimieren die Beziehung zwischen Zahnärzten und Patienten. Dies ist ein grundlegendes
Ziel von 3DISC, für das die Gesundheit der Zähne ein wichtiger Indikator für das Wohlbeﬁnden des Patienten ist.“

visualisieren. Diese interaktive Visualisierung erfolgt über ein Tablet,
das 3D-Abdrücke, 2D-Bilder und die
Behandlungspläne zeigt. Sie ermöglicht es den Patientinnen und Patienten, ihre Situation und die möglichen
Behandlungsoptionen besser zu verstehen und die bestmögliche Entscheidung zu treﬀen.

Neben der Übermittlung von
3D-Dateien an die Labore wird OVO
auch die Möglichkeit bieten, eine digitale Zusammenfassung mit Bildern
an die Patientinnen und Patienten zu
senden. Nach Aussagen von Anwenderinnen und Anwendern von OVO
wird das Gerät die tägliche Arbeit in
der Praxis prägen.

Though the intra-oral scanner
HERON IOS was voted the second
most popular intra-oral scanner by
dentists in 2022, 3DISC will enhance
its range by launching OVO, a product to reinvent the intra-oral scanner.
Intra-oral scanners have been the
greatest digital innovation of the last
ten years, perhaps since the advent of
digital dentistry. Thanks to increased
precision, speed of image acquisition
and just a few clicks to send dental impressions to dental laboratories, this
technology oﬀers real assistance to
dentists, specialists and their patients.
OVO is a technological revolution
in both hardware and software
thanks to the integrated 2D camera
and the Scan&Tell communication
software suite with smile design, buccal monitoring and more.

OVO is a clinical communication
tool allowing dentists and patients to
visualise dentition and possible treatments. This new, interactive visualisation is shared via a tablet showing
3D impressions, 2D images and the
dentist’s recommendations. It will
allow patients to better understand
their situation and treatment options
to make the best possible decision. In
addition to sending 3D ﬁles to the laboratories, OVO can send a digital summary including images to patients.
According to dentists who have used
OVO, it is a system that will be used
daily.
Marie-Laure Pochon, president of
3DISC says: “This new OVO scanner
is a major feat for 3DISC. We are taking a step ahead of other scanners.
We are bringing a new level of comfort to patients and improving the relationship between dentists and patients. This is a fundamental element
for 3DISC, for whom the health of the
teeth is a vital indication of the patient’s wellbeing.”

3DISC, USA
www.3disc.com
Hall 10.2
Booth M051

INNOVATION SCHLÄFT NIE: A-DEC PRÄSENTIERT NÄCHSTE NEUENTWICKLUNG AUF DER IDS
INNOVATION NEVER SLEEPS: A-DEC TO SHARE ITS NEXT NEW DEVELOPMENT AT IDS
Können Sie das machen? Dieser
Satz von Zahnärztinnen und Zahnärzten löst heute noch das gleiche
innovative Denken aus, um Probleme bei Dentalgeräten kreativ zu
lösen, wie vor fast 60 Jahren, als
A-dec aufgrund einer Erﬁndung und
eines Traums gegründet wurde.
Schon damals wusste A-dec, dass
zahnmedizinisches Personal, das
die Produkte täglich verwendet, die
beste Innovationsquelle ist. Im Laufe
der Jahre hat das Unternehmen ein

großes Netzwerk von Zahnärztinnen und Zahnärzten sowie wichtigen Meinungsführern aufgebaut, mit
denen es eng zusammenarbeitet
und Praxistests durchführt. Es ist
ebendiese ergebnisorientierte Innovation, die A-dec hilft, Probleme in
der Praxis zu verstehen und gleichzeitig die Möglichkeit bietet, Lösungen zu ﬁnden, die zur Verbesserung
beitragen. Mit zunehmendem Bewusstsein für Berührungspunkte
und Desinfektion in Praxen in den

letzten zehn Jahren entwickelte
A-dec Behandlungsstühle, Hocker,
Leuchten, Behandlungssysteme, Möbel und Produkte zur Wasseraufbereitung. Jetzt rüstet das Unternehmen für die nächste Innovation auf.

Innovation ruht nie
„Making the best better“ [Das
Beste besser machen] liegt in der
DNA von A-dec, und kein Detail ist
zu klein. Da jeder Abschnitt im Herstellungsprozess für die gesamte Pro-

duktpalette eine wichtige Rolle
spielt, kontrolliert A-dec den gesamten Prozess von der Konstruktion
und Fertigung bis zur Montage.
A-dec stellt sogar die meisten Teile
selbst her, angefangen bei der Beschaﬀung des Rohmaterials, über
das Drehen, Bohren und Fräsen ﬁndet alles im Werk der Firmenzentrale
in Oregon in den USA statt. Es gibt
keinen besseren Weg, um die Zuverlässigkeit, Langlebigkeit und konstante Leistung sicherzustellen. A-dec
entwickelt jedes einzelne Bauteil seiner Geräte auf die Weise, sodass das
gesamte Praxisteam von besseren
Arbeitsabläufen, Eﬃzienz und Komfort proﬁtiert.
Seien Sie versichert, dass A-dec
nie aufhören wird, innovativ zu sein –
von Behandlungsstühlen und -systemen über Praxismöbel und -leuchten bis hin zu Kompressoren, Absauganlagen und Entkeimungsanlagen. Kommen Sie und sehen Sie, was
als Nächstes kommt.
Can you do this? That phrase from
dentists today prompts the same
spark to creatively solve dental
equipment challenges as it did nearly
60 years ago when A-dec was founded
on an invention and a dream. Even
then, A-dec knew that the best sources
of innovation are the dental teams
who use the products every day.
Through the years, the company has
built a large network of dentist advocates and key opinion leaders with
whom it partners and ﬁeld-tests. It is
this outcome-driven innovation that
helps A-dec understand pain points

40th International Dental Show 2023 • 16. März 16 March

and identify opportunities to create
and improve. With increased awareness of touchpoints and of sanitisation in practices over the past decade,
A-dec designs dental chair units,
stools, lights, delivery systems, furniture and waterline maintenance products with this in mind. Now, the company is ramping up for the next
innovation.

Innovation never settles
“Making the best better” is in
A-dec’s DNA, and no detail is too
small. Since every part of the manufacturing process matters across the
full line of products, it controls the
entire process, including engineering,
manufacturing and assembly. The
company even makes the majority of
the parts it uses—sourcing the raw
materials, then turning, drilling and
milling them at its main site in Oregon in the US. There is no better way
to ensure reliability, longevity and
consistent performance. A-dec designs every piece of its equipment to
help dental teams enjoy better workﬂow, eﬃciency and comfort.
From dental chair units and delivery systems to dental furniture and
lights, to mechanical room equipment
and sterilisation centres, rest assured, A-dec will never stop innovating. Come see what’s next!

A-dec, USA
www.a-dec.com
Hall 11.1
Booth D010/E019

[55] =>

industry

POWER STEAMER VON RENFERT: DAMPFSTRAHLER SETZT
NEUEN MASSSTAB IN PUNCTO ZUVERLÄSSIGKEIT

Renfert bringt mit dem POWER steamer seinen ersten Dampfstrahler auf den Markt. Der
neue Dampfstrahler zeigt, wie intelligentes
Engineering richtig funktioniert. Ausgeklügelt bis ins feinste Detail wird der POWER
steamer zum echten Performance-Meister.
Mit dem POWER steamer betreten Dentallabore beim Abdampfen ein neues Level. Der
Dampfstrahler mit wartungsfreiem Heizelement
und intelligentem Engineering ergänzt die Laborausstattung mit smarten Funktionen, ansprechendem Design und verlässlicher Dampfleistung. Herzstück ist der Kessel, in dem das
Heizelement im Aluminiumboden vergossen ist.
Damit ist ein echter Ingenieursstreich gelungen,
der das Heizelement nahezu unverwüstlich
macht.

Dank konstantem Druck (4,5 bar)
in Kombination mit der IT-Düse (Intelligent-Technologie) werden Werkstückoberﬂächen gründlich gesäubert. Die IT-Düse bewirkt einen fokussierten Dampfstrahl; der POWER
steamer hat somit eine vergleichbare eﬀektive Reinigungsleistung
wie Geräte mit 5 oder 6 bar Arbeitsdruck, schont aber zugleich die
Werkstückoberﬂäche. Die leistungsstarke Heizung sorgt für eine kurze
Aufheizzeit bzw. ein schnelles, permanentes Nachheizen. Intelligentes
Engineering gewährleistet den
Dauerbetrieb. Weiteres raﬃniertes
Detail: Die extragroße Revisionsöﬀnung im Druckbehälter steht für
ein komfortables Spülen und Entkalken.
Mit Volldampf durch den Laboralltag –
selbst bei hoher Frequentierung bewahrt das
Gerät volle Power. Zudem machen anwenderfreundliches Handling und gewohnte RenfertServices aus einem einst biederen Alltagsgerät (Dampfstrahler) den POWER steamer. Alle
Komponenten haben die gewohnt hohe RenfertQualität. Hier treﬀen verlässliche Ingenieursleistung und aus- geklügelter Anwendungskomfort auf zahntechnische Expertise.

VERTIKALES KNOCHENWACHSTUM SICHERSTELLEN
MIT NEOGEN CAPE
ENSURE VERTICAL BONE GROWTH WITH NEOGEN CAPE
Die NeoGen Cape-Membran ist eine neue
Art von Polytetraﬂuorethylen (PTFE)-Membran,
die es nur bei Neoss gibt. Sie ist eine Erweiterung der erfolgreichen NeoGen PTFE-Familie,
die nachweislich das Nachwachsen von verlorenem Knochen unterstützt. Diese Lösung für
vorhersagbares vertikales Knochenwachstum
hilft bei bukkalen Knochendeﬁziten in der ästhetischen Zone und benötigt dank der direkten Fixierung am Implantat wenig Behandlungsschritte. Die Einzigartigkeit dieser neuen
implantatgetragenen Einzelzahnmembran aus
PTFE liegt sowohl in der anatomischen Hauptgeometrie als auch in der Art und Weise, wie
sie auf den Neoss-Implantaten befestigt wird.
Die Konturen der Membran sind so gestaltet,
dass eine manuelle Anpassung der äußeren
Form nicht erforderlich ist.
Überzeugen Sie sich noch heute am
Neoss-Messestand auf der IDS.

PTFE family which has proven to support the
regeneration of lost bone. This solution for predictable vertical bone growth helps with buccal
bone deﬁciencies in the aesthetic zone and
needs only few treatment steps owing to direct
ﬁxation on the implant. This new single-tooth
PTFE implant-secured membrane has its uniqueness in the main anatomical geometry as well
as in the way of securing it on the Neoss implants. The membrane’s contours are tailored to
minimise the need for manual outer shape adjustment.
Make sure to check it out today at the Neoss
booth.

Neoss, Switzerland
www.neoss.com
Hall 11.3
Booth G010/H029

The NeoGen Cape membrane is a new type

of Polytetraﬂuoroethylene (PTFE)
membrane that is exclusively
available from Neoss. It
is the latest addition to
the successful NeoGen

Renfert, Germany
www.renfert.com
Hall 10.1
Booth B010/C019

Now, the next breakthrough is here.

U . S . P AT E N T N O 1 1 , 1 1 6 , 7 0 1 B 2

Learn more: Hall 10.1, Stand A021
40th International Dental Show 2023 • 16. März 16 March
For more information, email contact@pulpdent.com or visit pulpdent.com
For more information, email contact@pulpdent.com or visit pulpdent.com
80 Oakland Street • Watertown, MA 02472 • USA
80 Oakland Street • Watertown, MA 02472 • USA

[56] =>

industry

OSSTELL – DAS ORIGINAL MIT ÜBER 1.300 PUBLIKATIONEN OSSTELL—THE ORIGINAL WITH OVER 1,300 PUBLICATIONS

Osstell

Die innovative Technologie von Osstell ermöglicht sichere und eﬀektive Implantationsverfahren. Implantologinnen und Implantologen können schnell und einfach feststellen,
welche Implantate bereits prothetisch versorgt oder mit Prothesen belastet werden können und welche noch mehr Einheilzeit benötigen. Daraus resultieren mehr Sicherheit
und Behandlungsqualität.
Osstells Methode basiert auf der Resonanzfrequenzanalyse, die es ermöglicht, die Stabilität eines Implantats im Knochen berührungsfrei zu messen, ohne die Einheilung zu be-

einträchtigen. Das Ergebnis der Messung wird
als Implantatstabilitätsquotient (ISQ) mit einem
Wert zwischen 1 und 100 ausgegeben. Dabei
gilt, je höher der Wert, desto stabiler ist das
Implantat. Durch die Ermittlung des ISQ-Werts
können Implantologinnen und Implantologen
sicherstellen, dass Implantate erst nach ausreichender Einheilzeit belastet werden.
Osstells innovative Technologie garantiert
einen echten Mehrwert für alle Beteiligten.
Zahnärztinnen und Zahnärzte können den ISQWert als Orientierungshilfe nutzen, um klinisch
fundierte Entscheidungen zu treﬀen. Osstells

ISQ-Technologie ist wissenschaftlich durch mehr
als 1.300 Studien gestützt. Ein besonderes Highlight ist das Osstell ConsultationTool und der
Behandlungsbericht, der Patientinnen und Patienten über den Verlauf und Erfolg der Behandlung informiert. Das ConsultationTool hilft
außerdem bei der Planung und Entscheidungsﬁndung. Einheilzeiten werden beispielsweise
für verschiedene klinische Situationen und Implantate optimiert. So können Behandlungszeiträume mitunter verkürzt werden.
Mit dem neuen ConsultationTool von Osstell
kann der Prozess der Implantatbehandlung für
Patientinnen und Patienten veranschaulicht
werden. Die Software ermöglicht es, die verschiedenen Schritte eines Implantationsverfahrens auf wissenschaftlich fundierte, aber leicht
verständliche Weise, zu beschreiben. Osstell
trägt somit dazu bei, Implantationsverfahren
sicherer zu machen und das Vertrauen und die
Patienten-Compliance zu stärken.
Osstell’s innovative technology allows for
safe and eﬀective dental implant procedures.
Implantologists can quickly and easily determine which implants have already been prosthetically loaded or can be loaded with prosthetics, and which implants still need more healing
time. This results in higher safety and treatment quality.
Osstell’s method is based on resonance frequency analysis, which allows clinicians to
measure the stability of an implant in the bone
in a contactless manner and without any impact
on the biological healing. The result of this
measurement is given as an implant stability

quotient (ISQ) with a value between 1 and 100―
the higher the value, the more stable the implant. By determining the ISQ value, implantologists can ensure that implants are only loaded
until they have healed suﬃciently.
Osstell’s innovative technology guarantees
added value for all stakeholders. Clinicians can
use the ISQ value as a guide to make evidence-based decisions as more than 1,300 scientiﬁc publications support the beneﬁts of the
ISQ technology. A special highlight is the Osstell
ConsultationTool and the treatment report,
which informs patients about the progress and
success of the treatment. The tool also helps
with planning and decision-making. For example, healing times are optimised for diﬀerent
clinical situations and implants, allowing for a
shorter treatment period at times.
With Osstell’s new ConsultationTool, the implant treatment process can be visualised for
patients. It simpliﬁes communication with patients and ensures transparency and trust. The
software helps dental professionals describe the
diﬀerent steps of an implant procedure in a scientiﬁcally based but easy-to-understand way.
Osstell therefore helps make implant procedures safer and to increase patient conﬁdence
and compliance.

W&H Group, Austria
www.wh.com
Hall 10.1
Booth A020/B029, A002

FDI FEIERT AM 20. MÄRZ WELTMUNDGESUNDHEITSTAG FDI TO CELEBRATE WORLD ORAL HEALTH DAY ON 20 MARCH
is an essential part of overall health, and therefore, it calls upon people to look after their oral
health for a lifetime of smiles.

Jedes Jahr am 20. März feiern Menschen auf
der ganzen Welt den Weltmundgesundheitstag (World Oral Health Day, WOHD), um auf
die immense Belastung durch Mundkrankheiten aufmerksam zu machen. Die dreijährige
Kampagne mit dem Motto „Sei stolz auf deinen Mund“ geht nun in das letzte Jahr. Schätzungen zufolge sind fast 3,5 Milliarden Menschen von Munderkrankungen betroﬀen, die
sich auf ihr Wohlbeﬁnden und ihre Lebensqualität auswirken. Die WOHD-Kampagne betont, dass die Gesunderhaltung des Mundes
in jedem Alter ein wesentlicher Bestandteil
der allgemeinen Gesundheit ist, und ruft daher die Menschen dazu auf, sich um ihre
Mundgesundheit zu kümmern, damit sie ein
Leben lang lächeln können.

Get involved and celebrate World
Oral Health Day with millions across
the world

Beteiligen Sie sich und feiern Sie
den Weltmundgesundheitstag
mit Millionen Menschen auf der
ganzen Welt
Der Weltverband der Zahnärzte FDI ist
davon überzeugt, dass jeder dazu beitragen
kann, der Belastung durch Mundkrankheiten
entgegenzuwirken, indem der WOHD gefeiert
wird und die vorgefertigten und anpassbaren
Informationsmaterialien der Kampagne weitergegeben werden, um das Bewusstsein für die
Bedeutung der Mundgesundheit in allen Lebensabschnitten zu schärfen. Unter den Materialien beﬁnden sich Aktions-Toolkits, Informationsblätter, Karten mit den wichtigsten
Botschaften, Anzeigen, individuelle Poster und
Bilder.
Eine weitere Möglichkeit zur Teilnahme bietet die neu gestartete #MouthProudChallenge,
die Einzelpersonen dazu motiviert, sich der
Online-Kampagnenbewegung anzuschließen, indem sie das Online-Polaroid-Tool der Kampagne oder Instagram- und Facebook-Filter nutzen, um eine Botschaft über ihren Mund und
dessen Bedeutung für sie zu teilen.

Denn ein gesunder Mund bedeutet, dass
man die alltäglichen Dinge des Lebens zu
schätzen weiß, wie z. B. eine Mahlzeit zu genießen, sich mit dem Nachbarn zu unterhalten, mit Familie und Freunden zu lachen, aus
Spaß zu singen, geliebte Menschen zu küssen
und sich wohlzufühlen.
Seien Sie an diesem WOHD stolz auf Ihren
Mund, damit Sie ein Leben lang lächeln können, und inspirieren Sie andere, dasselbe zu
tun.
Weitere Informationen über WOHD, die
Ressourcen der Kampagne, die #MouthProud-

Challenge und das Online-Polaroid-Tool ﬁnden
Sie unter www.worldoralhealthday.org.
Every year on 20 March, people around the
globe unite to celebrate World Oral Health Day
(WOHD) and put the spotlight on the immense
burden caused by oral disease. The campaign is
entering the ﬁnal year of the three-year “Be
proud of your mouth” theme. It is estimated that
oral disease aﬀects nearly 3.5 billion people,
having an impact on their well-being and quality of life. The WOHD campaign emphasises
that maintaining a healthy mouth at all ages

40th International Dental Show 2023 • 16. März 16 March

FDI believes everyone can help address the
oral disease burden by celebrating WOHD and
sharing the campaign’s ready-made and customisable resources, including action toolkits, fact
sheets, key message cards, advertisements, custom posters and frames, in order to raise awareness of the importance of taking care of oral
health at all stages of life.
Another way to participate is to take part
in the newly started #MouthProud challenge,
which motivates individuals to join the online
campaign movement by utilising the campaign’s
online polaroid tool or Instagram and Facebook
ﬁlters in order to share a message about their
mouth and what it means to them.
After all, a healthy mouth means being able
to appreciate everyday aspects of life, such as
enjoying a meal, talking to a neighbour, laughing
with family and friends, singing for fun, kissing
loved ones and feeling great.
This WOHD, be proud of your mouth for a
lifetime of smiles, and inspire others to do the
same.
More information on WOHD, the campaign’s
resources, the #MouthProud challenge and the
online polaroid tool can be found at www.
worldoralhealthday.org.

FDI World Dental Federation,
Switzerland
www.fdiworlddental.org
Hall 11.2, Booth N069

[57] =>

.1
0
1
:
l
l
a
H
t
a
s
9
u
2
t
0
i
s
i
C
V
8
2
0
B
:
Stand

[58] =>

industry

Patienten bevorzugen die Guided Biofilm Therapy
Patients prefer Guided Biofilm Therapy
Ein Beitrag von Dr. Jan H. Koch. A contribution by Dr Jan H. Koch.
Die Voraussetzung für eine gute
orale und allgemeine Gesundheit ist
ein sauberer Mund. Aufgeklärte Patienten wissen das und gehen regelmäßig zur professionellen Prophylaxe. Eine weltweite Fragebogen-Erhebung zur bevorzugten Methode ergab im Zeitraum Mai 2021 bis März
2022 bei über 76.000 Patientinnen
und Patienten eine 92-prozentige
Zustimmung für die Guided Bioﬁ lm Therapy (GBT). Durch die kontinuierliche Weiterführung der Umfrage konnten die Ergebnisse bis
Anfang März 2023 sogar von über
200.000 Teilnehmerinnen und Teilnehmern bestätigt werden.
Die Weltgesundheitsorganisation
hat orale Erkrankungen, einschließlich Karies und Parodontitis, als zentrales Gesundheitsproblem benannt.1, 2
Patienten können dies verhindern,
indem sie auf eine gesunde Lebensweise achten und mit fachgerechter
Mundhygiene regelmäßig und eﬀektiv den Bioﬁlm entfernen.3, 4 Von großer Bedeutung ist auch die professionelle Zahnreinigung (PZR). Dafür
verwendete Methoden, Instrumente
und Materialien sollten daher dem
Stand der Technik entsprechen.5, 6

Methodenvergleich
Mit der GBT hat EMS gemeinsam mit Forschern und Praktikern
ein systematisches, umfassend dokumentiertes Ablaufprotokoll entwickelt (Abb. 1). Ziel ist eine möglichst
vollständige und minimalinvasive Rei-

des Anfärbens vor Behandlungsbeginn und zum direkten Vergleich mit
der konventionellen Methode.

Diskussion und
Schlussfolgerungen

1
Ablaufprotokoll der Guided Bioﬁ lm Therapy. Guided Bioﬁlm Therapy procedure protocol.

nigung der oralen Oberﬂächen.7 Nach
obligatorischem Anfärben wird zunächst der Bioﬁlm sehr schonend mit
AIR-FLOWING entfernt.8 Erst dann
wird für verbleibende harte Beläge
ein praktisch schmerzfreies piezokeramisches Ultraschall-Instrument
(PIEZON PS NO PAIN) eingesetzt.
Dagegen steht bei konventionellen PZR-Verfahren die Entfernung
harter Beläge mit invasiven Schalloder Handinstrumenten im Vordergrund. Durch die nachfolgende Politur wird unnötigerweise oberﬂächliche Zahnsubstanz abgetragen.9 Um
Zeit zu sparen, wird zudem vor Be-

ginn der Belagentfernung häuﬁg nicht
angefärbt. Dadurch bleibt signiﬁkant
mehr Bioﬁlm zurück als mit dem für
die GBT standardisiert eingesetzten
Anfärben.10, 11

Fragebögen und Ergebnisse
Die für die hier vorgestellte Umfrage anonymisierten Fragebogen wurden EMS von präventiv orientierten
Praxen und Kliniken zur Verfügung
gestellt. Diese verwenden systematisch das empfohlene GBT-Protokoll.
Die Bogen enthielten acht Fragen zur
Gesamtbeurteilung der GBT, erreichten Oberﬂächenglätte, Sinnhaftigkeit

Mehr als 92 Prozent der Patienten bevorzugten im Vergleich zum
konventionellen Vorgehen das systematische GBT-Prophylaxe-Protokoll.
Dies stimmt mit bereits publizierten
Studien überein.5, 6, 12 Die GBT eignet
sich risiko- und bedarfsbezogen sowohl für die primär-präventive PZR,
als auch für die sekundär-präventive
Parodontitis- und Periimplantitis-Therapie. Aufgrund ihres hohen praktischen Nutzens in Verbindung mit ihrer umfassenden wissenschaftlichen
Dokumentation wird sie von zahlreichen hochrangigen Experten aus Praxis und Hochschule empfohlen.8, 13–16
Die in der Umfrage ermittelte
hohe Patientenzufriedenheit führt in
der täglichen Praxis zu einer sehr
guten Recall-Quote. Die GBT lässt sich
somit besonders eﬃzient umsetzen
und macht die Prophylaxe auch wirtschaftlich hochinteressant.
The basis of good oral and general health is a clean mouth. Well-informed patients know this and visit
the dentist for professional prophy-

(PIEZON PS NO PAIN) is used for remaining calculus.
In contrast, conventional professional prophylaxis procedures focus
on removing hard plaque with invasive sonic or hand instruments. The
subsequent so-called polishing unnecessarily removes superﬁcial tooth substance.9 In addition, in order to save
time, disclosing is often not performed
prior to the start of plaque removal.
As a result, signiﬁcantly more bioﬁlm
remains than with the standardised
discloser used for GBT.10, 11

Questionnaires and results
The questionnaires anonymised for
the survey presented here were provided to EMS by prevention-oriented
practices and clinics. These systematically use the recommended GBT protocol. The questionnaires contained
eight questions, including overall assessment of GBT, surface smoothness
achieved, usefulness of disclosing prior
to treatment, and direct comparison
with the conventional method.

Discussion and conclusions
More than 92% of patients preferred the GBT systematic prophylaxis
protocol compared with the conventional approach. This is consistent

THE GLOBAL DENTAL CE COMMUNITY

laxis regularly. An on-going global
survey using questionnaires on the
preferred method showed that 92% of
patients (76,000), who completed the
survey between May 2021 and March
2022, favoured Guided Bioﬁlm Therapy (GBT). To date, the results have
been conﬁrmed by more than 200,000
survey participants.
The World Health Organization
has identiﬁed oral diseases, including
caries and periodontitis, as a key health
problem.1, 2 Patients can prevent this
by paying attention to a healthy lifestyle and using personal oral hygiene
measures regularly and eﬀectively to
remove microbial plaque (bioﬁlm).3, 4
Professional prophylaxis is also of
great importance. Methods, instruments,
and materials used for this should
therefore be state of the art.5, 6

with previously published studies.5, 6, 12
Based on the risk and needs of the individual patient, GBT is suitable for both
primary preventive prophylaxis and
secondary preventive periodontitis
and peri-implantitis therapy. Owing to
its high practical beneﬁt in combination with its comprehensive scientiﬁc
documentation, it is recommended by
numerous high-ranking experts from
practice and academia.8, 13–16
The high level of patient satisfaction determined in the survey leads
to a very good recall rate in daily
practice. GBT can therefore be implemented particularly eﬃciently and
makes prophylaxis highly interesting
from an economic point of view.

Literature

Method comparison

Tribune Group is an ADA CERP Recognized Provider. ADA CERP is a service of the American Dental Association to assist dental professionals in identifying quality providers of continuing dental education. ADA CERP does not approve or endorse
individual courses or instructors, nor does it imply acceptance of credit hours by boards of dentistry.This continuing education activity has been planned and implemented in accordance with the standards of the ADA Continuing Education Recognition Program (ADA CERP) through joint efforts between Tribune Group and Dental Tribune Int. GmbH.

With GBT, EMS has developed
a systematic, comprehensively documented clinical protocol together with
researchers and practitioners (Fig. 1).
The aim is to clean all oral surfaces as
completely and minimally invasive as
possible.7 After mandatory dicslosing,
the bioﬁlm is ﬁrst removed very gently
with AIR-FLOWING.8 Only then the painless piezoceramic ultrasonic instrument

40th International Dental Show 2023 • 16. März 16 March

EMS Electro Medical
Systems, Switzerland
www.ems-dental.com
Hall 11.2
Booth L010/M019

[59] =>

[60] =>

industry

KÜNSTLICHE INTELLIGENZ VON ALLISONE ARTIFICIAL INTELLIGENCE WITH ALLISONE

Allisone ist ein Patientenkommunikationstool, das künstliche Intelligenz
(KI) verwendet, um bestimmte Elemente von Röntgenbildern hervorzuheben und Patientinnen und Patienten eine Visualisierung der Versorgung zu bieten. Der Zahnarzt und Firmengründer Dr. Lionel Elbaz sagt,
dass KI die Patientenerfahrung verbessern kann und dass die Zukunft
den Zahnärztinnen und Zahnärzten
gehört, die die Technologie beherrschen.

Wie entwickelt sich die
Zahnmedizin?
Die gesamte Gesundheitsbranche beﬁndet sich in einem globalen
Wandel, weil sich die Erwartungen
der Patienten auf unterschiedliche
Weise verändern. Sie betrachten die
Versorgung anders, sie bauen keine
lebenslange Vertrauensbeziehung zu
ihren Ärzten mehr auf, weil sie bei
Enttäuschungen leicht zu anderen
Ärzten gehen können und Zugang zu
Informationen haben, die ihnen helfen, selbst zu entscheiden, ob sie behandelt werden wollen oder nicht.
Zweitens ist die Gesundheitsfürsorge eine soziale Angelegenheit und
Patienten erwarten eine persönliche
Betreuung und Beziehungen zu ihren Behandlern. Und schließlich erwarten sie ein Erlebnis. Heute ist die
Welt digitalisiert und Marken verkaufen nicht mehr nur ein Produkt
oder eine Dienstleistung, sondern
ein ganzes Erlebnis, das das tägliche
Leben einfacher, schneller und zuverlässiger macht. Das erwarten die

Patienten jetzt auch von der Gesundheitsversorgung.

Wie sind Sie auf die Idee mit
Allisone gekommen?
Ich habe Allisone mit einem
zentralen Ziel gegründet: Unsere
Zahnarztpraxen zu digitalisieren,
um die Patientenerfahrung einfach,
transparent, vertrauenswürdig, zuverlässig, schnell und sicher zu machen. Das Ziel ist auch, unsere tägliche Praxis als Zahnärzte bequemer
zu machen.
Die beste Versorgung ist eine
Grundvoraussetzung, aber die beste
Erfahrung ist es nicht, weil wir das
nicht an der Universität gelernt haben. Aber letzten Endes kann man
der beste Zahnarzt sein, wenn der
Patient einem jedoch nicht vertraut, wird man ihn nicht behandeln können. Deshalb glaube ich,
dass die Technologie unsere Versorgung verbessern wird.

Wie hilft die Allisone Zahnärztinnen und Zahnärzten?
In Frankreich entscheiden sich
nur 35 Prozent der Patienten nach
einer Beratung für eine Behandlung.
Dies hat Folgen für die allgemeine
Gesundheit der Patienten und lässt
sich teilweise durch mangelndes
Bewusstsein der Patienten für die
Bedeutung der Behandlung erklären.
Allisone ist ein Patientenkommunikationstool, das KI verwendet, um
bestimmte Elemente auf Röntgenaufnahmen hervorzuheben – wie zum
Beispiel frühere Behandlungen und

Röntgenstrahlen – und um Patienten
die erforderliche Versorgung zu veranschaulichen.

Wie sieht Ihre Vision von
der Zukunft der Zahnmedizin
aus?
Seit einigen Jahren bieten die
Technologien zahlreiche Innovationen, zum Beispiel Hardware, Röntgen,
intraorale Bildgebung und CBCT. Das
Problem ist, dass diese Technologien
in einem geschlossenen Kreislauf
konzipiert sind, was die tägliche Praxis der Zahnärzte erschwert. Meine
Vision ist, dass die KI durch die Verknüpfung der Tools in einer oﬀenen
Umgebung die zahnärztliche Leistung
drastisch steigern kann. Die Technologie ist nicht dazu da, den Zahnarzt
zu ersetzen, sondern um seine Erfahrung zu verbessern.
Die Zukunft ist vernetzt, interoperabel und ﬂießend. Meine Vision der
strahlendsten Zukunft beinhaltet die
KI, weil Menschen und KI das zuverlässigste, schnellste, leistungsfähigste
und sicherste Duo bilden, das bisher
von keiner anderen Technologie erreicht werden konnte. Mit Allisone
bauen wir an dieser Zukunft.
Allisone is a patient communication
tool that uses artiﬁcial intelligence
(AI) to highlight certain elements of dental radiographs and to provide visualisation of care to patients. Dental surgeon
and company founder Dr Lionel Elbaz
says that AI can improve the patient experience and that the future belongs to
dentists who master the technology.

How is dentistry evolving?
The global health industry is
changing because patients’ expectations are changing in diﬀerent ways.
Firstly, patients look at care diﬀerently.
They no longer build a lifelong relationship with their dentist, because they
can easily access other practitioners
and ﬁnd information themselves about
treatment. Secondly, healthcare is social, and patients expect personalised
care and relationships with their caregivers. Lastly, they expect an experience. Today, the world is digitised, and
brands no longer sell a product or service; rather, they sell an experience
that aims to make daily life easier,
more eﬃcient and more reliable. That
is what patients expect from healthcare now.

Why did you found Allisone?
I founded Allisone with one key
objective: to digitise dental oﬃces in
order to make the patient experience
easy, transparent, trustworthy, reliable, fast and safe. The aim was also to
make our daily practice—as dentists—
more convenient.
Giving the best care is a prerequisite, but giving the best experience is
not, because dentists did not learn how
to provide this while at university. At
the end of the day, you can be an excellent dental surgeon, but if the patient
does not trust you, you will not be able
to treat him or her. That is why I believe that technology is here to help.
How is Allisone helping dentists?
In France, only 35 % of patients decide to accept treatment after a consul-

tation. This has consequences for the
general health of patients and can be
partly explained by a lack of patient
awareness regarding the importance
of treatment. Allisone is a patient communication tool that uses AI to highlight certain elements of dental radiographs—such as past treatments and
radiolucencies — and to provide patients with visualisations of the required care.

What is your vision for the
future of dentistry?
For some years now, there have
been multiple innovations in various
areas of technology, including in hardware, radiography, intra-oral imaging
and CBCT. The problem is that these
technologies are designed in a closed
loop, which complicates dentists’ daily
work. My vision is that AI can, by connecting the tools in one open environment, drastically boost dental performance. Technology is not here to
replace the practitioner, but to enhance his or her experience.
The future is connected, interoperable and ﬂuid. My vision of the brightest future includes AI because, when
clinicians and AI work together, they
form the safest, most reliable and fastest team—no other technology can
equal that. With Allisone, we are building this future.

Allisone, France
www.allisone.ai
Hall 11.1, Booth G050

MEGAGEN’S ANYRIDGE—NEW GLOBAL STANDARD FOR IMPLANT DESIGN
As the name suggests, the MegaGen’s
AnyRidge implant system can be
used for any implant case. However,
clinical results show that its beneﬁts
are particularly signiﬁcant in cases
with immediate or early loading—
even in situations with compromised
bone density.
AnyRidge allows dentists to oﬀer
patients new smiles faster than ever.
It facilitates the preservation of cortical bone, promotes strong osseointe-

AnyRidge.

gration faster, permits stability from
the start and oﬀers an incredible implant–prosthetic connection with a
fantastic soft-tissue response.
Despite the growing body of clinical evidence demonstrating the beneﬁts of the AnyRidge implant system
for both dentists and patients, some
clinicians may still be reluctant to use
it, owing to their habit of using other
implants and standard techniques.
That is why MegaGen has introduced

BLUEDIAMOND

IMPLANT.

the latest member of the AnyRidge
family: BLUEDIAMOND IMPLANT.
Though it has a slightly diﬀerent
implant body shape and connection,
BLUEDIAMOND IMPLANT still incorporates many of the key features of
AnyRidge. It oﬀers a simple solution
for clinicians wishing to oﬀer the best
to their patients without signiﬁcantly
changing their surgical protocols.
BLUEDIAMOND IMPLANT is made of
pure medical-grade titanium that is
backed by more than 20 years of clinical evidence demonstrating its biocompatibility. It is designed to create
less bone stress and, by oﬀering a
200% increase in compressive
strength, prioritises the implant’s
long-term mechanical stability.
BLUEDIAMOND IMPLANT’s unique
KnifeThread design allows for superior initial stability in situations with
compromised bone. Combined with
diﬀerent thread depth options, this
enables easy implant placement with

good primary stability in all bone densities. BLUEDIAMOND IMPLANT is
also available in various ﬁxture diameters for all tooth sizes, enabling it to
be placed even in larger osteotomy
sockets.
Devised from architectural principles, the arch-type keystone that
forms BLUEDIAMOND IMPLANT’s
X-FIT connection improves long-term
mechanical stability while delivering
high levels of resistance to external
compressive forces, such as mastication, by excellently dispersing stress.
Furthermore, the abutment can
be precisely rotated in 45° increments, allowing for accurate positioning, particularly when using an angled abutment. In this way, it reduces
unnecessary chair time through a
prosthetic design that minimises
screw loosening.
Available in a variety of sizes, the
AnyRidge prosthetic line-up satisﬁes
all clinical needs, such as overden-

tures, all-on-four, digital prostheses
and general prostheses. To secure the
aesthetic results needed for implants
in the anterior zone, the RC-BASE
abutment has been made available
as a prosthetic component in the
AnyRidge implant system.
The RC-BASE possesses an angled tool channel, which allows for
the position of the screw access
hole in the anterior zone to be
changed if necessary. Its innovative
double-pitch screw is designed to
minimise sinking down by employing the screw’s thread as a stopper,
which also prevents screw loosening and the cold-welding phenomenon that can occur between ﬁxture
and abutment.
MegaGen Implant,
South Korea
www.imegagen.com
Hall 4.2, Booth K070

[61] =>

[62] =>

travel

Was ist sonst noch los in Köln?
What’s on in Cologne?

Belgisches Viertel
• Wo: Brüsseler Platz, Köln
Kölns Belgisches Viertel ist an jedem Abend der Woche ein gutes
Ausﬂugsziel. Dort kommen Besucherinnen und Besucher sowie Einheimische zusammen, um Kölns
kulinarische Vielfalt zu entdecken,
einzukaufen oder in einer Bar zu
entspannen. Rund um den Brüsseler
Platz, wo die neoromanische Kirche
St. Michael steht, gibt es unzählige
Boutiquen, Theater, Cafés, Bars und
Restaurants. Wenn Sie es tagsüber
hierher schaﬀen, halten Sie Ausschau nach cafecafe, einem kleinen,
trendigen Café mit bunt gestreiftem
Interieur, warmen und kalten Kaffeespezialitäten und einem köstlichen Mittagsmenü. Wer auf der Suche nach einem zweiten Zuhause
ist, sollte abends bei der Wohngemeinschaft vorbeischauen, die CaféBar, Theater und Hostel zugleich ist.
Ein Drink auf einem Retro-Barhocker
in diesem freundlichen Lokal ist
vielleicht genau das Richtige!

Kölner Schokoladenmuseum
• Wann: Täglich, 10:00–18:00 Uhr
• Wo: Am Schokoladenmuseum 1a,
50678 Köln
• Informationen:
www.schokoladenmuseum.de

Seien wir ehrlich: Obwohl wir
versuchen, unsere Zähne gut zu pﬂegen, gehört Schokolade zu den Versuchungen, denen man nur schwer
widerstehen kann. Wer es ins berühmte Kölner Schokoladenmuseum
schaﬀ t, wird es nicht bereuen.
Ebenso ist der Geschenkeladen ein
Muss.

„Blumen, Flowers, Fleurs“
• Wann: 10:00–18:00 Uhr
• Wo: Museum für Angewandte
Kunst Köln, An der Rechtschule 7,
50667 Köln
• Informationen: makk.de
Wenn Sie etwas Ruhe brauchen,
besuchen Sie das Museum für Angewandte Kunst Köln, eines der größten Museen für angewandte Kunst
in Deutschland. Die temporäre Ausstellung „Blumen, Flowers, Fleurs“
besteht aus schillernden, überlebensgroßen Wollbildern der deutschen Künstlerin Susanna Taras. Die
Künstlerin spielt mit Farben, Maßstäben und Formen und möchte in
den Hallen der Kunstinstitutionen
ein Gefühl von Poesie erzeugen.

Love Me More
• Wann: 19:30 Uhr
• Wo: Schauspiel Köln,
Schanzenstraße 6–20, 51063 Köln

• Informationen:
www.schauspiel.koeln
Das Stück des israelischen Choreographen Saar Magal, das an der
Schnittstelle zwischen Tanz und Theater angesiedelt ist, nimmt Bezug auf
Oscar Wildes Das Bildnis des Dorian
Gray und untersucht den Narzissmus und die Verlockungen der ewigen Jugend. Als sinnliche Collage beschrieben, ist Magals Erkundung von
Begehren, Selbstliebe und endloser
Optimierung sehr zu empfehlen. Das
Stück ist in englischer und deutscher
Sprache und dauert 90 Minuten.

Belgian Quarter
• Where: Brüsseler Platz (Brussels
square), Cologne
Cologne’s Belgian Quarter is a good
destination on any night of the week.
There, visitors and locals come together to discover Cologne’s culinary
diversity, to go shopping or to relax
in a bar. Around Brussels square,
where the neo-Romanesque church of
St Michael stands, there are countless boutiques, theatres, cafes, bars
and restaurants. If you make it here
during the day, keep an eye out for
cafecafe, a small, trendy cafe with a
colourfully striped interior, hot and

cold coﬀee specialities, and a mouthwatering lunch menu. In the evenings, those who are looking for a
home away from home might consider dropping by die Wohngemeinschaft. Its name means “shared ﬂat”,
and the café-bar, theatre and hostel
is arranged according to the whims
of its four ﬁctitious housemates. A
drink while sitting on a retro barstool in this friendly establishment
may be just the ticket!

Cologne chocolate museum
• When: Daily, 10:00–18:00
• Where:
Am Schokoladenmuseum 1a,
50678 Cologne
• Information:
www.schokoladenmuseum.de
Let’s face it: although we try to
take good care of our teeth, chocolate
is one of those temptations that is
hard to resist. Those who make it to
the famous Cologne chocolate museum will not regret it. Likewise, the
gift shop is a must-see.

“Blumen, Flowers, Fleurs”
• When: 10:00–18:00
• Where: Museum für Angewandte
Kunst Köln (Cologne museum of
applied arts), An der Rechtschule 7,
50667 Cologne

• Information: makk.de
If you are in need of some peace
and quiet, why not visit the Museum
für Angewandte Kunst Köln, one of
the largest museums of applied art in
Germany. The temporary exhibition
“Blumen, Flowers, Fleurs” consists of
iridescent, larger-than-life woollen
paintings by the German artist Susanna Taras. The artist plays with
colour, scale and form and aims to
create a sense of poetry in the halls
of art institutions.

Love Me More
• When: 19:30
• Where: Schauspiel Köln,
Schanzenstraße 6–20,
51063 Cologne
• Information:
www.schauspiel.koeln
At the intersection of dance and
theatre, this play by Israeli choreographer Saar Magal makes reference
to Oscar Wilde’s The Picture of Dorian Gray as it examines narcissism
and the allure of eternal youth. Described as a sensuous collage, Magal’s
exploration of desire, self-love and
endless optimisation comes highly
recommended. The play is in English
and German and runs for 90 minutes.

About the publisher
Editorial/Administrative Office
ARGE IDS today GBR
Dental Tribune International GmbH
OEMUS MEDIA AG
Holbeinstraße 29
04229 Leipzig
Germany
Phone
+49 341 48474-302
Fax
+49 341 48474-173
Websites
www.zwp-online.info
www.dental-tribune.com
Publisher
Torsten Oemus
Representative,
Dental Tribune International GmbH
Torsten Oemus

40th International Dental Show 2023 • 16. März 16 March

Representatives, OEMUS MEDIA AG
Ingolf Döbbecke, Lutz Hiller
Chief Content Officer
Claudia Duschek (V.i.S.d.P.)
Editors
Franziska Beier, Jeremy Booth, John Cisnik, Anisha Hall
Hoppe, Christin Hiller, Kerstin Oesterreich, Iveta Ramonaite
Production Executive
Gernot Meyer
Production
Lisa Greulich, Fanny Haller, Aniko Holzer, Alexander Jahn,
Frank Jahr, Pia Krah, Stephan Krause, Timon Leidenheimer,
Josephine Ritter, Franziska Schmid, Sarah Schröter, Nora
Sommer-Zernechel
today appears during the 40th International Dental Show in
Cologne on 16 March 2023. The newspaper and all articles
and illustrations therein are protected by copyright. Any utilisation without prior consent from the editor or publisher
is inadmissible and liable to prosecution. No responsibility
shall be assumed for information published about associations, companies and commercial markets. General terms
and conditions apply; legal venue is Leipzig, Germany.

[63] =>

www.zwp-online.info

Seid ihr auch

?

#ADDICTED
Wir sind es!

Nach News, News und
noch mehr News!

OEMUS MEDIA AG

Holbeinstraße 29 · 04229 Leipzig · Deutschland
Tel.: +49 341 48474-0 · info@oemus-media.de

[64] =>

OUR WORLD.

BESUCHEN SIE UNS
AUF UNSEREM STAND
AUF DER IDS
HALLE 05.2.
STAND D-051

SWISS PREMIUM ORAL CARE

) [page_count] => 64 [pdf_ping_data] => Array ( [page_count] => 64 [format] => PDF [width] => 794 [height] => 1134 [colorspace] => COLORSPACE_UNDEFINED ) [linked_companies] => Array ( [ids] => Array ( ) ) [cover_url] => [cover_three] =>

[cover] => today at IDS Cologne 16 March 2023

[toc] => Array ( [0] => Array ( [title] => News [page] => 1 ) [1] => Array ( [title] => Sicherheit, Flexibilität und Einfachheit – NiTi-Feilen für jeden Wurzelkanal - Safety, flexibility and simplicity—NiTi files for every root canal [page] => 8 ) [2] => Array ( [title] => News [page] => 10 ) [3] => Array ( [title] => Industry [page] => 18 ) [4] => Array ( [title] => Was ist sonst noch los in Köln? - What’s on in Cologne? [page] => 62 ) ) [toc_html] =>

Table of contents

[toc_titles] =>

[cached] => true )