today at IDS Cologne 14 March 2023
News
/ Mit edelweiss dentistry die optimale Integration von Funktion und Ästhetik realisieren - Realising optimal integration of function and aesthetics with edelweiss dentistry
/ Fachhändler setzt auf Weitsicht und Regionalität - Retailer focuses on further development and regional markets
/ Impressionen des Vor-IDS-Tages - Impressions from the pre-IDS day
/ Industry
/ Was ist sonst noch los in Köln? - What’s on in Cologne?
/ Was man zur IDS wissen muss - Useful information
Array
(
[post_data] => WP_Post Object
(
[ID] => 86999
[post_author] => 0
[post_date] => 2023-03-13 23:11:44
[post_date_gmt] => 2023-03-13 22:48:47
[post_content] =>
[post_title] => today at IDS Cologne 14 March 2023
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => today-at-ids-cologne-14-march-2023
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:58
[post_modified_gmt] => 2024-12-18 10:31:58
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/epaper/today-at-ids-cologne-14-march-2023/
[menu_order] => 0
[post_type] => epaper
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 86999
[id_hash] => 66e470439fc6c26b7b672c9d98c9822a33cfe9f06780b6f107ce0bdce9f0d60e
[post_type] => epaper
[post_date] => 2023-03-13 23:11:44
[fields] => Array
(
[pdf] => Array
(
[ID] => 87000
[id] => 87000
[title] => today at IDS Cologne 14 March 2023.pdf
[filename] => today at IDS Cologne 14 March 2023.pdf
[filesize] => 0
[url] => https://e.dental-tribune.com/wp-content/uploads/today at IDS Cologne 14 March 2023.pdf
[link] => https://e.dental-tribune.com/epaper/today-at-ids-cologne-14-march-2023/today-at-ids-cologne-14-march-2023-pdf/
[alt] =>
[author] => 0
[description] =>
[caption] =>
[name] => today-at-ids-cologne-14-march-2023-pdf
[status] => inherit
[uploaded_to] => 86999
[date] => 2024-12-18 10:31:52
[modified] => 2024-12-18 10:31:52
[menu_order] => 0
[mime_type] => application/pdf
[type] => application
[subtype] => pdf
[icon] => https://e.dental-tribune.com/wp-includes/images/media/document.png
)
[cf_issue_name] => today at IDS Cologne 14 March 2023
[cf_edition_number] => 14032023
[publish_date] => 2023-03-13 23:11:44
[contents] => Array
(
[0] => Array
(
[from] => 1
[to] => 6
[title] => News
[description] => News
)
[1] => Array
(
[from] => 8
[to] => 8
[title] => Mit edelweiss dentistry die optimale Integration von Funktion und Ästhetik realisieren - Realising optimal integration of function and aesthetics with edelweiss dentistry
[description] => Mit edelweiss dentistry die optimale Integration von Funktion und Ästhetik realisieren - Realising optimal integration of function and aesthetics with edelweiss dentistry
)
[2] => Array
(
[from] => 10
[to] => 12
[title] => Fachhändler setzt auf Weitsicht und Regionalität - Retailer focuses on further development and regional markets
[description] => Fachhändler setzt auf Weitsicht und Regionalität - Retailer focuses on further development and regional markets
)
[3] => Array
(
[from] => 14
[to] => 14
[title] => Impressionen des Vor-IDS-Tages - Impressions from the pre-IDS day
[description] => Impressionen des Vor-IDS-Tages - Impressions from the pre-IDS day
)
[4] => Array
(
[from] => 18
[to] => 76
[title] => Industry
[description] => Industry
)
[5] => Array
(
[from] => 78
[to] => 78
[title] => Was ist sonst noch los in Köln? - What’s on in Cologne?
[description] => Was ist sonst noch los in Köln? - What’s on in Cologne?
)
[6] => Array
(
[from] => 79
[to] => 79
[title] => Was man zur IDS wissen muss - Useful information
[description] => Was man zur IDS wissen muss - Useful information
)
)
[seo_title] =>
[seo_description] =>
[seo_keywords] =>
[fb_title] =>
[fb_description] =>
)
[permalink] => https://e.dental-tribune.com/epaper/today-at-ids-cologne-14-march-2023/
[post_title] => today at IDS Cologne 14 March 2023
[client] =>
[client_slug] =>
[pages_generated] =>
[pages] => Array
(
[1] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-0.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-0.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-0.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-0.jpg
[1000] => 86999-01099430/1000/page-0.jpg
[200] => 86999-01099430/200/page-0.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87001
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-1-ad-87001
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-1-ad-87001
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-1-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87001
[id_hash] => 97b465e1c52bade77ef01a25ba771bb9bfe0565fd6531928e4f8368fb8b4a87c
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/clearcorrect-5/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-1-ad-87001/
[post_title] => epaper-86999-page-1-ad-87001
[post_status] => publish
[position] => 78.47533632287,44.270015698587,15.470852017937,11.773940345369
[belongs_to_epaper] => 86999
[page] => 1
[cached] => false
)
[1] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87020
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-1-ad-87020
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-1-ad-87020
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-1-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87020
[id_hash] => bbef80e9cec5d68f6e6f6a4e8d40fe3a8f6d9d08a4e422cfeaa2973f03030e51
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/exocad/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-1-ad-87020/
[post_title] => epaper-86999-page-1-ad-87020
[post_status] => publish
[position] => 59.865470852018,58.712715855573,34.529147982063,37.676609105181
[belongs_to_epaper] => 86999
[page] => 1
[cached] => false
)
)
[html_content] =>
)
[2] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-1.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-1.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-1.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-1.jpg
[1000] => 86999-01099430/1000/page-1.jpg
[200] => 86999-01099430/200/page-1.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[3] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-2.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-2.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-2.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-2.jpg
[1000] => 86999-01099430/1000/page-2.jpg
[200] => 86999-01099430/200/page-2.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87002
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-3-ad-87002
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-3-ad-87002
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-3-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87002
[id_hash] => f8754f55333eb662f2fa61d8542c42aadd87f9551ac7261c39a872f5b672faac
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/3shape/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-3-ad-87002/
[post_title] => epaper-86999-page-3-ad-87002
[post_status] => publish
[position] => 1.1210762331839,0.47095761381476,98.654708520179,99.372056514914
[belongs_to_epaper] => 86999
[page] => 3
[cached] => false
)
)
[html_content] =>
)
[4] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-3.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-3.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-3.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-3.jpg
[1000] => 86999-01099430/1000/page-3.jpg
[200] => 86999-01099430/200/page-3.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[5] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-4.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-4.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-4.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-4.jpg
[1000] => 86999-01099430/1000/page-4.jpg
[200] => 86999-01099430/200/page-4.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[6] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-5.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-5.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-5.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-5.jpg
[1000] => 86999-01099430/1000/page-5.jpg
[200] => 86999-01099430/200/page-5.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[7] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-6.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-6.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-6.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-6.jpg
[1000] => 86999-01099430/1000/page-6.jpg
[200] => 86999-01099430/200/page-6.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[8] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-7.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-7.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-7.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-7.jpg
[1000] => 86999-01099430/1000/page-7.jpg
[200] => 86999-01099430/200/page-7.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[9] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-8.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-8.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-8.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-8.jpg
[1000] => 86999-01099430/1000/page-8.jpg
[200] => 86999-01099430/200/page-8.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87003
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-9-ad-87003
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-9-ad-87003
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-9-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87003
[id_hash] => e346c1e6c3963941a457c283b5a739c57f075d11a8dc30e799d4b0afb30ef1e1
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/e-m-s-electro-medical-systems-s-a/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-9-ad-87003/
[post_title] => epaper-86999-page-9-ad-87003
[post_status] => publish
[position] => 1.1210762331839,0.15698587127159,98.430493273543,99.686028257457
[belongs_to_epaper] => 86999
[page] => 9
[cached] => false
)
)
[html_content] =>
)
[10] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-9.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-9.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-9.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-9.jpg
[1000] => 86999-01099430/1000/page-9.jpg
[200] => 86999-01099430/200/page-9.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[11] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-10.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-10.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-10.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-10.jpg
[1000] => 86999-01099430/1000/page-10.jpg
[200] => 86999-01099430/200/page-10.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[12] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-11.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-11.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-11.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-11.jpg
[1000] => 86999-01099430/1000/page-11.jpg
[200] => 86999-01099430/200/page-11.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[13] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-12.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-12.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-12.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-12.jpg
[1000] => 86999-01099430/1000/page-12.jpg
[200] => 86999-01099430/200/page-12.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87004
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-13-ad-87004
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-13-ad-87004
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-13-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87004
[id_hash] => 0d763b61c8c08d01afb0f163b95494773747c38e529c48ce969f130886e5fb61
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/clearcorrect-5/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-13-ad-87004/
[post_title] => epaper-86999-page-13-ad-87004
[post_status] => publish
[position] => 1.3452914798206,0.62794348508634,98.430493273543,99.215070643642
[belongs_to_epaper] => 86999
[page] => 13
[cached] => false
)
)
[html_content] =>
)
[14] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-13.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-13.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-13.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-13.jpg
[1000] => 86999-01099430/1000/page-13.jpg
[200] => 86999-01099430/200/page-13.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87005
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-14-ad-87005
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-14-ad-87005
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-14-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87005
[id_hash] => 7daaa2eb250b4261a02b2f1b50a02cebae59a40ef14782952d6a9c4a39d3c62a
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/shining-3d/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-14-ad-87005/
[post_title] => epaper-86999-page-14-ad-87005
[post_status] => publish
[position] => 0.22421524663677,50.235478806907,99.551569506726,49.607535321821
[belongs_to_epaper] => 86999
[page] => 14
[cached] => false
)
)
[html_content] =>
)
[15] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-14.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-14.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-14.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-14.jpg
[1000] => 86999-01099430/1000/page-14.jpg
[200] => 86999-01099430/200/page-14.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[16] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-15.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-15.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-15.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-15.jpg
[1000] => 86999-01099430/1000/page-15.jpg
[200] => 86999-01099430/200/page-15.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[17] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-16.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-16.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-16.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-16.jpg
[1000] => 86999-01099430/1000/page-16.jpg
[200] => 86999-01099430/200/page-16.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[18] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-17.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-17.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-17.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-17.jpg
[1000] => 86999-01099430/1000/page-17.jpg
[200] => 86999-01099430/200/page-17.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[19] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-18.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-18.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-18.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-18.jpg
[1000] => 86999-01099430/1000/page-18.jpg
[200] => 86999-01099430/200/page-18.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87006
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-19-ad-87006
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-19-ad-87006
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-19-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87006
[id_hash] => 228ba9f6000831cfb7eaed1048656c39d5fc0dc54d927bd6a9bc54c41bcce91c
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/sprintray/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-19-ad-87006/
[post_title] => epaper-86999-page-19-ad-87006
[post_status] => publish
[position] => 0.89686098654709,0.47095761381476,98.430493273543,98.744113029827
[belongs_to_epaper] => 86999
[page] => 19
[cached] => false
)
)
[html_content] =>
)
[20] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-19.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-19.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-19.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-19.jpg
[1000] => 86999-01099430/1000/page-19.jpg
[200] => 86999-01099430/200/page-19.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87007
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-20-ad-87007
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-20-ad-87007
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-20-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87007
[id_hash] => 631cf00c60f4fd6b37b6e4bda82327c26898d80b8fb492192c76137395fc20cc
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/kuraray-noritake/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-20-ad-87007/
[post_title] => epaper-86999-page-20-ad-87007
[post_status] => publish
[position] => 0.44843049327354,50.235478806907,99.32735426009,49.607535321821
[belongs_to_epaper] => 86999
[page] => 20
[cached] => false
)
)
[html_content] =>
)
[21] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-20.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-20.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-20.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-20.jpg
[1000] => 86999-01099430/1000/page-20.jpg
[200] => 86999-01099430/200/page-20.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87008
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-21-ad-87008
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-21-ad-87008
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-21-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87008
[id_hash] => 0ea54865ab019508d9e6b8b2b086187b1d818260413ddfbd88d3fb35a9a73584
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/gc-international/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-21-ad-87008/
[post_title] => epaper-86999-page-21-ad-87008
[post_status] => publish
[position] => 0.22421524663677,0.31397174254317,98.654708520179,99.215070643642
[belongs_to_epaper] => 86999
[page] => 21
[cached] => false
)
)
[html_content] =>
)
[22] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-21.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-21.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-21.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-21.jpg
[1000] => 86999-01099430/1000/page-21.jpg
[200] => 86999-01099430/200/page-21.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[23] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-22.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-22.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-22.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-22.jpg
[1000] => 86999-01099430/1000/page-22.jpg
[200] => 86999-01099430/200/page-22.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[24] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-23.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-23.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-23.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-23.jpg
[1000] => 86999-01099430/1000/page-23.jpg
[200] => 86999-01099430/200/page-23.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[25] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-24.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-24.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-24.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-24.jpg
[1000] => 86999-01099430/1000/page-24.jpg
[200] => 86999-01099430/200/page-24.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[26] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-25.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-25.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-25.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-25.jpg
[1000] => 86999-01099430/1000/page-25.jpg
[200] => 86999-01099430/200/page-25.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[27] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-26.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-26.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-26.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-26.jpg
[1000] => 86999-01099430/1000/page-26.jpg
[200] => 86999-01099430/200/page-26.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[28] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-27.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-27.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-27.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-27.jpg
[1000] => 86999-01099430/1000/page-27.jpg
[200] => 86999-01099430/200/page-27.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[29] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-28.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-28.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-28.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-28.jpg
[1000] => 86999-01099430/1000/page-28.jpg
[200] => 86999-01099430/200/page-28.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87009
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-29-ad-87009
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-29-ad-87009
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-29-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87009
[id_hash] => 00a456eb4d0bac3faf6b87549caeee600179eae7684b8ac70047f59f1f97e7fa
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/ivoclar/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-29-ad-87009/
[post_title] => epaper-86999-page-29-ad-87009
[post_status] => publish
[position] => 1.1210762331839,0.15698587127159,98.654708520179,99.686028257457
[belongs_to_epaper] => 86999
[page] => 29
[cached] => false
)
)
[html_content] =>
)
[30] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-29.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-29.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-29.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-29.jpg
[1000] => 86999-01099430/1000/page-29.jpg
[200] => 86999-01099430/200/page-29.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[31] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-30.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-30.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-30.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-30.jpg
[1000] => 86999-01099430/1000/page-30.jpg
[200] => 86999-01099430/200/page-30.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87010
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-31-ad-87010
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-31-ad-87010
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-31-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87010
[id_hash] => 1925c39d2990e469876fae84fbc295508e9676d3f8cc2009d2585385171973f8
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/hassbio/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-31-ad-87010/
[post_title] => epaper-86999-page-31-ad-87010
[post_status] => publish
[position] => 42.600896860987,0.31397174254317,57.174887892377,99.529042386185
[belongs_to_epaper] => 86999
[page] => 31
[cached] => false
)
)
[html_content] =>
)
[32] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-31.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-31.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-31.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-31.jpg
[1000] => 86999-01099430/1000/page-31.jpg
[200] => 86999-01099430/200/page-31.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[33] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-32.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-32.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-32.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-32.jpg
[1000] => 86999-01099430/1000/page-32.jpg
[200] => 86999-01099430/200/page-32.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87011
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-33-ad-87011
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-33-ad-87011
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-33-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87011
[id_hash] => 73e485703883c13c7a4f3b90ab3c2d6a258533a467f1735739bb4e42fef7487b
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/curaden-ag/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-33-ad-87011/
[post_title] => epaper-86999-page-33-ad-87011
[post_status] => publish
[position] => 0.30959752321981,0.43290043290043,99.38080495356,98.701298701299
[belongs_to_epaper] => 86999
[page] => 33
[cached] => false
)
)
[html_content] =>
)
[34] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-33.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-33.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-33.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-33.jpg
[1000] => 86999-01099430/1000/page-33.jpg
[200] => 86999-01099430/200/page-33.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[35] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-34.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-34.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-34.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-34.jpg
[1000] => 86999-01099430/1000/page-34.jpg
[200] => 86999-01099430/200/page-34.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[36] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-35.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-35.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-35.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-35.jpg
[1000] => 86999-01099430/1000/page-35.jpg
[200] => 86999-01099430/200/page-35.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87012
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-36-ad-87012
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-36-ad-87012
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-36-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87012
[id_hash] => b77c08205f8fb3638076aaaf9ef7a1b62fd8f5358d1212f41d39e24c71eea057
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dtstudyclub.com/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-36-ad-87012/
[post_title] => epaper-86999-page-36-ad-87012
[post_status] => publish
[position] => 5.2631578947368,56.060606060606,52.941176470588,36.796536796537
[belongs_to_epaper] => 86999
[page] => 36
[cached] => false
)
)
[html_content] =>
)
[37] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-36.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-36.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-36.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-36.jpg
[1000] => 86999-01099430/1000/page-36.jpg
[200] => 86999-01099430/200/page-36.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[38] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-37.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-37.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-37.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-37.jpg
[1000] => 86999-01099430/1000/page-37.jpg
[200] => 86999-01099430/200/page-37.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[39] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-38.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-38.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-38.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-38.jpg
[1000] => 86999-01099430/1000/page-38.jpg
[200] => 86999-01099430/200/page-38.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87013
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-39-ad-87013
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-39-ad-87013
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-39-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87013
[id_hash] => 7bacd056cf4d76dceb573f2faf6d065d23e8a4ee6a5f92c75b00fa3a1876b6e9
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/durr-dental-se/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-39-ad-87013/
[post_title] => epaper-86999-page-39-ad-87013
[post_status] => publish
[position] => 0.30959752321981,0.21645021645022,99.38080495356,99.5670995671
[belongs_to_epaper] => 86999
[page] => 39
[cached] => false
)
)
[html_content] =>
)
[40] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-39.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-39.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-39.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-39.jpg
[1000] => 86999-01099430/1000/page-39.jpg
[200] => 86999-01099430/200/page-39.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[41] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-40.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-40.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-40.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-40.jpg
[1000] => 86999-01099430/1000/page-40.jpg
[200] => 86999-01099430/200/page-40.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[42] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-41.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-41.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-41.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-41.jpg
[1000] => 86999-01099430/1000/page-41.jpg
[200] => 86999-01099430/200/page-41.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[43] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-42.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-42.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-42.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-42.jpg
[1000] => 86999-01099430/1000/page-42.jpg
[200] => 86999-01099430/200/page-42.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[44] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-43.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-43.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-43.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-43.jpg
[1000] => 86999-01099430/1000/page-43.jpg
[200] => 86999-01099430/200/page-43.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[45] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-44.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-44.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-44.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-44.jpg
[1000] => 86999-01099430/1000/page-44.jpg
[200] => 86999-01099430/200/page-44.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87014
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-45-ad-87014
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-45-ad-87014
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-45-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87014
[id_hash] => 7ec4ebd009c2d6fea7b889791308a892d10fbd7d4de39520e5703878870ae479
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/gc-international/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-45-ad-87014/
[post_title] => epaper-86999-page-45-ad-87014
[post_status] => publish
[position] => 0.30959752321981,0.43290043290043,99.38080495356,99.134199134199
[belongs_to_epaper] => 86999
[page] => 45
[cached] => false
)
)
[html_content] =>
)
[46] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-45.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-45.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-45.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-45.jpg
[1000] => 86999-01099430/1000/page-45.jpg
[200] => 86999-01099430/200/page-45.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[47] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-46.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-46.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-46.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-46.jpg
[1000] => 86999-01099430/1000/page-46.jpg
[200] => 86999-01099430/200/page-46.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[48] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-47.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-47.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-47.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-47.jpg
[1000] => 86999-01099430/1000/page-47.jpg
[200] => 86999-01099430/200/page-47.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[49] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-48.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-48.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-48.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-48.jpg
[1000] => 86999-01099430/1000/page-48.jpg
[200] => 86999-01099430/200/page-48.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[50] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-49.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-49.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-49.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-49.jpg
[1000] => 86999-01099430/1000/page-49.jpg
[200] => 86999-01099430/200/page-49.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[51] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-50.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-50.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-50.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-50.jpg
[1000] => 86999-01099430/1000/page-50.jpg
[200] => 86999-01099430/200/page-50.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87015
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-51-ad-87015
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-51-ad-87015
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-51-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87015
[id_hash] => cd33bf1a7fc6056f71e2307e9e957eaf9487cfc23642cb0ec61c595f254d0358
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/3disc-imaging/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-51-ad-87015/
[post_title] => epaper-86999-page-51-ad-87015
[post_status] => publish
[position] => 0.30959752321981,0.64935064935065,99.38080495356,99.134199134199
[belongs_to_epaper] => 86999
[page] => 51
[cached] => false
)
)
[html_content] =>
)
[52] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-51.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-51.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-51.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-51.jpg
[1000] => 86999-01099430/1000/page-51.jpg
[200] => 86999-01099430/200/page-51.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[53] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-52.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-52.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-52.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-52.jpg
[1000] => 86999-01099430/1000/page-52.jpg
[200] => 86999-01099430/200/page-52.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87016
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-53-ad-87016
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-53-ad-87016
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-53-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87016
[id_hash] => 827bfe6c924c2e2c6ce20659c32b19ecdf2b656d2cd5ba803205e2097850c92e
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/curaden-ag/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-53-ad-87016/
[post_title] => epaper-86999-page-53-ad-87016
[post_status] => publish
[position] => 0.30959752321981,0.21645021645022,99.071207430341,99.5670995671
[belongs_to_epaper] => 86999
[page] => 53
[cached] => false
)
)
[html_content] =>
)
[54] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-53.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-53.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-53.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-53.jpg
[1000] => 86999-01099430/1000/page-53.jpg
[200] => 86999-01099430/200/page-53.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[55] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-54.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-54.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-54.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-54.jpg
[1000] => 86999-01099430/1000/page-54.jpg
[200] => 86999-01099430/200/page-54.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[56] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-55.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-55.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-55.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-55.jpg
[1000] => 86999-01099430/1000/page-55.jpg
[200] => 86999-01099430/200/page-55.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[57] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-56.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-56.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-56.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-56.jpg
[1000] => 86999-01099430/1000/page-56.jpg
[200] => 86999-01099430/200/page-56.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[58] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-57.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-57.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-57.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-57.jpg
[1000] => 86999-01099430/1000/page-57.jpg
[200] => 86999-01099430/200/page-57.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[59] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-58.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-58.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-58.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-58.jpg
[1000] => 86999-01099430/1000/page-58.jpg
[200] => 86999-01099430/200/page-58.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[60] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-59.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-59.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-59.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-59.jpg
[1000] => 86999-01099430/1000/page-59.jpg
[200] => 86999-01099430/200/page-59.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[61] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-60.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-60.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-60.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-60.jpg
[1000] => 86999-01099430/1000/page-60.jpg
[200] => 86999-01099430/200/page-60.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87017
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-61-ad-87017
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-61-ad-87017
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-61-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87017
[id_hash] => 87c3bc5ac5052f313d11ecaeb64084f9103fc03c05709235cc806f923dc351f2
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/dmp-dental-industry/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-61-ad-87017/
[post_title] => epaper-86999-page-61-ad-87017
[post_status] => publish
[position] => 0.030961641955302,0.17316000802176,99.69040247678,99.350649350649
[belongs_to_epaper] => 86999
[page] => 61
[cached] => false
)
)
[html_content] =>
)
[62] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-61.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-61.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-61.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-61.jpg
[1000] => 86999-01099430/1000/page-61.jpg
[200] => 86999-01099430/200/page-61.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[63] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-62.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-62.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-62.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-62.jpg
[1000] => 86999-01099430/1000/page-62.jpg
[200] => 86999-01099430/200/page-62.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87018
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-63-ad-87018
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-63-ad-87018
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-63-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87018
[id_hash] => 7207e2ca5a2b7f01d5a3668620749ca9fecf79f12fc3f61999491b1397a1cfa3
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/fdi-world-dental-federation/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-63-ad-87018/
[post_title] => epaper-86999-page-63-ad-87018
[post_status] => publish
[position] => 0.92879256965944,0.43290043290043,98.452012383901,99.134199134199
[belongs_to_epaper] => 86999
[page] => 63
[cached] => false
)
)
[html_content] =>
)
[64] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-63.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-63.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-63.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-63.jpg
[1000] => 86999-01099430/1000/page-63.jpg
[200] => 86999-01099430/200/page-63.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[65] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-64.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-64.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-64.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-64.jpg
[1000] => 86999-01099430/1000/page-64.jpg
[200] => 86999-01099430/200/page-64.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[66] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-65.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-65.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-65.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-65.jpg
[1000] => 86999-01099430/1000/page-65.jpg
[200] => 86999-01099430/200/page-65.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[67] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-66.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-66.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-66.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-66.jpg
[1000] => 86999-01099430/1000/page-66.jpg
[200] => 86999-01099430/200/page-66.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[68] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-67.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-67.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-67.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-67.jpg
[1000] => 86999-01099430/1000/page-67.jpg
[200] => 86999-01099430/200/page-67.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[69] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-68.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-68.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-68.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-68.jpg
[1000] => 86999-01099430/1000/page-68.jpg
[200] => 86999-01099430/200/page-68.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[70] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-69.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-69.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-69.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-69.jpg
[1000] => 86999-01099430/1000/page-69.jpg
[200] => 86999-01099430/200/page-69.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[71] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-70.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-70.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-70.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-70.jpg
[1000] => 86999-01099430/1000/page-70.jpg
[200] => 86999-01099430/200/page-70.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[72] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-71.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-71.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-71.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-71.jpg
[1000] => 86999-01099430/1000/page-71.jpg
[200] => 86999-01099430/200/page-71.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[73] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-72.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-72.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-72.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-72.jpg
[1000] => 86999-01099430/1000/page-72.jpg
[200] => 86999-01099430/200/page-72.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[74] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-73.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-73.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-73.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-73.jpg
[1000] => 86999-01099430/1000/page-73.jpg
[200] => 86999-01099430/200/page-73.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[75] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-74.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-74.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-74.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-74.jpg
[1000] => 86999-01099430/1000/page-74.jpg
[200] => 86999-01099430/200/page-74.jpg
)
[ads] => Array
(
[0] => Array
(
[post_data] => WP_Post Object
(
[ID] => 87019
[post_author] => 0
[post_date] => 2024-12-18 10:31:52
[post_date_gmt] => 2024-12-18 10:31:52
[post_content] =>
[post_title] => epaper-86999-page-75-ad-87019
[post_excerpt] =>
[post_status] => publish
[comment_status] => closed
[ping_status] => closed
[post_password] =>
[post_name] => epaper-86999-page-75-ad-87019
[to_ping] =>
[pinged] =>
[post_modified] => 2024-12-18 10:31:52
[post_modified_gmt] => 2024-12-18 10:31:52
[post_content_filtered] =>
[post_parent] => 0
[guid] => https://e.dental-tribune.com/ad/epaper-86999-page-75-ad/
[menu_order] => 0
[post_type] => ad
[post_mime_type] =>
[comment_count] => 0
[filter] => raw
)
[id] => 87019
[id_hash] => 0668051e9f445a0cea03f1d0acda3d44f08fab3f75821c4c7c6563677a14aa68
[post_type] => ad
[post_date] => 2024-12-18 10:31:52
[fields] => Array
(
[url] => https://www.dental-tribune.com/c/roots-summit/
[link] => URL
)
[permalink] => https://e.dental-tribune.com/ad/epaper-86999-page-75-ad-87019/
[post_title] => epaper-86999-page-75-ad-87019
[post_status] => publish
[position] => 0.61919504643963,0.43290043290043,98.761609907121,99.350649350649
[belongs_to_epaper] => 86999
[page] => 75
[cached] => false
)
)
[html_content] =>
)
[76] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-75.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-75.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-75.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-75.jpg
[1000] => 86999-01099430/1000/page-75.jpg
[200] => 86999-01099430/200/page-75.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[77] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-76.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-76.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-76.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-76.jpg
[1000] => 86999-01099430/1000/page-76.jpg
[200] => 86999-01099430/200/page-76.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[78] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-77.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-77.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-77.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-77.jpg
[1000] => 86999-01099430/1000/page-77.jpg
[200] => 86999-01099430/200/page-77.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[79] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-78.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-78.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-78.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-78.jpg
[1000] => 86999-01099430/1000/page-78.jpg
[200] => 86999-01099430/200/page-78.jpg
)
[ads] => Array
(
)
[html_content] =>
)
[80] => Array
(
[image_url] => Array
(
[2000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/2000/page-79.jpg
[1000] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/1000/page-79.jpg
[200] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/200/page-79.jpg
)
[key] => Array
(
[2000] => 86999-01099430/2000/page-79.jpg
[1000] => 86999-01099430/1000/page-79.jpg
[200] => 86999-01099430/200/page-79.jpg
)
[ads] => Array
(
)
[html_content] =>
)
)
[pdf_filetime] => 1734517912
[s3_key] => 86999-01099430
[pdf] => today at IDS Cologne 14 March 2023.pdf
[pdf_location_url] => https://e.dental-tribune.com/tmp/dental-tribune-com/86999/today at IDS Cologne 14 March 2023.pdf
[pdf_location_local] => /var/www/vhosts/e.dental-tribune.com/httpdocs/tmp/dental-tribune-com/86999/today at IDS Cologne 14 March 2023.pdf
[should_regen_pages] => 1
[pdf_url] => https://epaper-dental-tribune.s3.eu-central-1.amazonaws.com/86999-01099430/epaper.pdf
[pages_text] => Array
(
[1] =>
untitled
AD
Tuesday
14 March
14.3.
updated daily
40th International Dental Show • Cologne • 14–18 March 2023
Interview
Interview
Impressions
Alles über das Produktportfolio von edelweiss
dentistry und sein Hybridglasmaterial.
Jörg Linneweh von dental bauer spricht über
neueste Entwicklungen beim Unternehmen.
VDDI sowie Planmeca und KaVo Dental
begrüßen Teilnehmende der IDS.
All about the edelweiss dentistry product
portfolio and its hybrid glass material.
Jörg Linneweh of dental bauer talks about the
latest developments at the company.
» 10
VDDI as well as Planmeca and KaVo Dental
welcome IDS participants.
» 14
Komplett
digitaler
Workflow
Complete
digital
workflow
Amann Girrbach auf der IDS 2023.
Amann Girrbach at IDS 2023.
„Connect To The (Work-)Flow“ ist
das Motto von Amann Girrbach auf
der IDS 2023 – das bedeutet Behandlungsabläufe in Dentallaboren und
-praxen miteinander zu verbinden.
Das können Besucherinnen und Besucher auf rund 640 Quadratmetern
Ausstellungsfläche live erleben. Im
Gespräch geben Geschäftsführer
Dr. Wolfgang Reim, Vice President
Marketing and Digital Christian Ermer
und Vice President Research and Development Falko Noack Einblicke in
den kompletten digitale Workflow
sowie Produkt-Highlights und Innovationen.
»2
» 08
Integrierte Workflows,
intelligentes Arbeiten
Integrated workflows,
smarter work
AD
People of today
3Shape präsentiert Komplettlösungen.
3Shape presents complete solutions.
Es ist unbestritten, dass digitale
Technologien die Arbeit in Dentalpraxen und Laboren bereichern. Es gab jedoch keine vollständige Lösung, die
die digitalen Punkte in Zahnkliniken
verbindet. Die 3Shape Unite-Plattform,
die 3Shape im Jahr 2021 herausbrachte,
revolutionierte die Arbeitsweise von
Zahnärztinnen und Zahnärzten. Die
neue offene Plattform brachte weltweit
führende Dentalunternehmen, Lösungen und Labore zusammen und ermöglichte es Zahnärztinnen und Zahnärzten, alle Fälle nahtlos und effizient zu
verwalten. Es eröffnete auch eine Welt
voller Möglichkeiten mit Tausenden
von Unite Store-Apps.
»4
Undisputedly, digital technologies enhance the work in dental
practices and laboratories. However, there was no complete solution that connects the digital dots
in dental clinics. When 3Shape released 3Shape Unite in 2021, it
revolutionised the way dental professionals work. The new open
platform brought world-leading
dental companies, solutions and
laboratories together and allowed
dental professionals to manage all
their cases seamlessly and efficiently. It also opened up a world
of opportunities with thousands
of Unite Store apps.
»4
Langzeitdaten zu zweiteiligen Zirkonoxidimplantaten
Long-term data on twopiece zirconia implants
us !
t
i
s
i
v
Come
Hall 11.3, Stand C010
Simon Campion, president and CEO of
Dentsply Sirona.
Wir schließen Lücken für unsere Kunden und stellen Workflow-Lösungen
bereit, die die bestmögliche Behandlung garantieren – in allen Bereichen
der Zahnmedizin.
We connect the dots for our customers and are committed to
delivering workflow solutions that
guarantee the best possible treatment—in every field of dentistry.
AD
Partners in
excellence.
United
by smiles.
Visit us @IDS | Hall 4.2
Stand G-080 J-089
AD
Imagine the CADabilities
Ein Interview mit Marco Waldner, CEO von Zircon Medical.
An interview with Marco Waldner, CEO of Zircon Medical.
Zolid Bion.
“Connect To The (Work-)Flow” is
Amann Girrbach’s motto for IDS
2023―meaning to connect workflows
in dental laboratories and practices.
Dental professionals can expect to
see this motto articulated across the
company’s 640 m2 of exhibition at
the trade fair. In this interview, CEO
Dr Wolfgang Reim, vice president of
marketing and digital Christian Ermer
and vice president of research and development Falko Noack give insights
into this complete digital workflow
and other innovations and product
highlights.
»2
Ende letzten Jahres wurde die erste
Langzeitstudie zu zweiteiligen Zirkonoxidimplantaten von Forschern
des Universitätsklinikums Düsseldorf
publiziert. Diese zeigte, dass osseointergierte Implantate der Marke
Patent nach neun Jahren gesundes
Weich gewebe, stabile Knochenniveaus und keinerlei Periimplantitis aufwiesen. Das Zürcher Unternehmen Zircon Medical ist der
Hersteller des Patent- Implantat systems und hat über 20 Jahre Erfahrung in der Bearbeitung des Werkstoffs Zirkonoxid. Der firmeneigene
Prozess zur Implantatherstellung
ist patentrechtlich geschützt und findet inhouse an zwei Produktionsstandorten in Bayern statt. Im Interview spricht Marco Waldner, CEO
Zircon Medical, über die Bedeutung
der Langzeitstudie.
»4
Conducted by researchers at the
University Hospital of Düsseldorf in
Germany, the first long-term study on
two-piece zirconia implants was published at the end of last year. The
study showed that osseointegrated
implants of the Patent brand exhibited healthy soft tissue, stable bone
levels and no peri-implantitis after
nine years. Zurich-based company
Zircon Medical is the manufacturer
of the Patent dental implant system
and has over 20 years of experience
in working with zirconia. The company’s proprietary implant production process is patent-protected, and
the entire implant production process takes place in-house at two sites
in Germany. In this interview, Marco
Waldner, CEO of Zircon Medical,
talks about the significance of the
long-term study.
»4
Sean Han, Dental Technologist
MEET US IN HALL 1, BOOTH A040 /C041
[2] =>
untitled
news
2
«1 – Amann Girrbach
Herr Dr. Reim, was hat es mit dem
Motto „Connect To The (Work-)Flow“
auf sich?
Unser Ziel ist es, den kompletten
Workflow für Restaurationen ganzheitlich auf höchstem Niveau zu ermöglichen. Wir bieten den Anwendern in Praxen und Laboren etwas,
das eine Summe von einzelnen Produkten nur schwerlich leisten kann:
Wir bieten ein offenes, jedoch validiertes Gesamtsystem aus innovativen, aufeinander abgestimmten Komponenten und sorgen so für hohe
Prozesssicherheit, einen deutlichen
Produktivitätsgewinn sowie Reproduzierbarkeit von Restaurationen in
höchster Qualität und Ästhetik. Quasi
„Peace of Mind“ was die technische
Komplexität entlang der Prozesskette
angeht. Es geht dabei darum, analoge
und digitale Schritte, sowie auch die
Anwender – Zahnärzte und Dentaltechniker – miteinander zu verbinden, um am Ende den Arbeitsalltag
für alle Beteiligten zu erleichtern. Der
digitale Workflow revolutioniert die
Welt der Dentaltechnologie, wovon
alle profitieren.
Herr Ermer, welche Produkte von
Amann Girrbach sind die aktuellen
Meilensteine?
Die Liste ist erfreulicherweise
lang. Dazu zählen die WorkflowCloud- Plattform AG.Live und das
modulare Ceramill Direct Restoration
Solution-(DRS-)System. AG.Live ist
dabei das Herzstück, an das alle
neuen und bestehenden Produkte
von Amann Girrbach angebunden
sind, und womit interdisziplinäre Lücken zwischen Labor und Praxis
überwunden werden.
Patientenfälle werden unter Einhaltung der EU- und internationalen
Datenschutzrichtlinien zentral ver-
Dr Wolfgang Reim.
waltet, was den interdisziplinären
Austausch wesentlich einfacher und
effizienter macht. Die Anbindung unserer Ceramill Labor-Maschinen an
AG.Live vereinfacht auch das Warenmanagement und den Service. Mit
dem modular aufgebauten System
Ceramill DRS und mit unserem Intraoralscanner Ceramill MAP DRS
schaffen wir die Voraussetzung für
eine lückenlose Zusammenarbeit zwischen Praxis und Labor – sowie für
ganz neue Möglichkeiten im Bereich
der Same Day-Dentistry. Mit dem
Ceramill DRS Production Kit, das die
Fräsmaschine Ceramill Motion DRS
und die Designsoftware Ceramill Mind
DRS beinhaltet, kann beispielsweise
eine Restauration in hoher Qualität
in nur einer Sitzung gefertigt werden.
Herr Noack, mit dem neuesten Produkt der Zirkonoxid-Familie lassen
Sie aktuell aufhorchen. Warum wird
das neue Zolid Bion als echter Gamechanger bezeichnet?
Mit Zolid Bion haben wir die Zirkonentwicklung auf ein neues Level
gehoben und die nächste Evolutionsstufe an vollkeramischen Materialien
aus Zirkonoxid erreicht, ohne bei der
Christian Ermer.
Sicherheit Kompromisse zu machen.
Zolid Bion basiert auf 15 Jahren Entwicklungsarbeit und ist so vielseitig
wie kein anderes Material. Seit knapp
zwei Jahren erscheinen vermehrt
3D-Zirkonoxide am Markt. Diese bieten zahlreiche Vorteile, vor allem hinsichtlich der Ästhetik und im Bereich
der Schneide. Bislang mussten dafür
aber Kompromisse zugunsten der Sicherheit eingegangen werden. Mit
Zolid Bion ist das nun vorbei – der innovative Werkstoff vereint Ästhetik
und Sicherheit in perfekter Weise,
ganz ohne Kompromisse und für einen optimalen Workflow. Der Grund
für diese kompromisslose Kombination von Ästhetik und Sicherheit
liegt in den innovativen Rohstoffen
begründet. Diese gewährleisten bei
Zolid Bion eine gleichbleibende Festigkeit von über 800 MPa über den gesamten Rohlingsquerschnitt. Ein absolutes Highlight ist auch, dass sich
Zolid Bion für das Speed-Sintern eignet. Das bedeutet in der Planung und
Anwendung volle Freiheit und Sicherheit – und dazu noch Schnelligkeit. Von minimalinvasiven Veneers
über monolithische Frontzahnkronen
bis hin zu weitspannigen Brücken auf
Falko Noack.
Implantaten – Anwender müssen sich
nicht mehr zwischen verschiedenen
Materialien entscheiden, sondern können mit Zolid Bion ein breites Indikationsspektrum bedienen.
Herr Dr. Reim, abschließend: Wie sieht
eine Zusammenarbeit mit Amann
Girrbach aus?
Der Kauf eines unserer Produkte
ist der Beginn einer Partnerschaft.
Wir legen viel Wert darauf, kontinuierlich für unsere Kunden da zu sein:
über ein breites Angebot von Trainings- und Weiterbildungsmaßnahmen,
einen starken technischen Service
mit sehr gut erreichbarem Helpdesk
und nicht zuletzt über regelmäßige
Updates der Funktionalität unserer
Produkte. Denn es ist unser oberstes
Anliegen, dafür zu sorgen, dass Anwender hochqualitative Ergebnisse
einfach, sicher und möglichst kostenund zeiteffizient erhalten.
Erfahren Sie mehr am Stand von Amann
Girrbach (C040/D041) in Halle 1.2. Eine Übersicht der täglichen Veranstaltungen am Firmenstand sind unter www.amanngirrbach.com/ids.
verfügbar.
«1– Amann Girrbach
AD
Sicher.
Sauber.
ALPRO.
rträglichkeit!
d QAV-freies FlüssigkonzenÀ[LHUHQGHQ5HLQLJXQJXQG
ztlichen und zahnärztlichen
üft und empfohlen von namFormulierung konnten die
hen korrosionsinhibitieen noch verbessert werden
KXW],KUHUNRUURVLRQVHPSÀQG-
Besuchen Sie uns
in Halle 11.2
Stand N 008/O 009
Dr Reim, What’s the story behind
“Connect To The (Work-)Flow”?
Our objective is to enable a complete workflow for restorations holistically and to the highest standards. We
offer users in dental practices and laboratories something which is difficult
to achieve with the sum of individual
products alone: we offer an overall
system of innovative, coordinated
components that is open and yet validated, thus ensuring high process
safety, a significant gain in productivity and reproducibility of restorations
of the highest quality and aesthetics. In
other words, we are offering peace of
mind as far as the technical complexity across the process chain is concerned. The idea is to link analogue
and digital steps, as well as users—
namely dentists and dental technicians—to ultimately make everyday
routines easier for everyone involved.
Digital workflows are revolutionising
dentistry, and everyone stands to benefit.
Mr Ermer, what are Amann Girrbach’s
current product milestones?
The list is a long one. It includes
the AG.Live workflow cloud platform
and the modular Ceramill Direct Restoration Solution (DRS) system for
chairside applications. AG.Live is the
core element, and all new and existing
products are connected with it, thus
bridging interdisciplinary divides between laboratories and dental practices.
Patient cases are managed centrally in compliance with EU and international data protection guidelines.
They can be accessed by all collaborators, and this makes interdisciplinary
exchange easier and more efficient.
The connection of Ceramill laboratory
machines to AG.Live also simplifies inventory management and service. In
addition, with the modular Ceramill
DRS system and our Ceramill MAP
DRS intra-oral scanner—both of which
are fully integrated into the digital ecosystem—we enable seamless interdisciplinary collaboration and create new
possibilities in the field of same-day
dentistry. For example, by using the
Ceramill DRS Production Kit, which
includes the Ceramill Motion DRS
milling machine and the Ceramill
Mind DRS design software, a highquality restoration can be produced
in just a single session.
Mr Noack, Amann Girrbach’s latest
product in the zirconia family is attracting considerable attention. Why
are people referring to the new Zolid
Bion as a game changer?
With Zolid Bion, we have raised
the development of zirconia to a new
level and advanced to the next evolutionary stage in all-ceramic materials
made of zirconia without compromising on safety. Zolid Bion is based on
15 years of development work and is
more versatile than any other material. For almost two years now, socalled 3D zirconia materials have been
appearing on the market. These offer
numerous advantages, particularly with
regard to aesthetics in the area of the
incisal edge. However, until now, compromises had to be made in the interests of safety. With Zolid Bion, this is
now a thing of the past. The innovative
material perfectly combines aesthetics with safety without making any
compromises and provides an optimal
workflow. This uncompromising combination of aesthetics and safety is attributable to the innovative raw materials used. These ensure a consistent
strength of over 800 MPa over the entire cross section of the blank. Another
highlight is its suitability for speed
sintering. In terms of planning and application, this means absolute freedom and safety, plus speed. From minimally invasive veneers and monolithic
anterior crowns to long-span bridges
on implants, users no longer have to
choose between different materials
and can cover a wide range of indications with Zolid Bion.
Dr Reim, to sum things up, what does
a cooperation with Amann Girrbach
entail?
The purchase of one of our products marks the beginning of a partnership. We attach great importance to
offering continuous support to our
customers via a wide range of training
and education activities, highly competent technical service with an easily
accessible help desk, and regular updates on the functionality of our products. After all, our primary objective
is to ensure that users achieve
high-quality results simply, reliably
and as cost-effectively and quickly as
possible.
Learn more at Amann Girrbach’s booth
(#C040/D041) in Hall 1.2. An overview of daily
events at the company’s booth can be found at
www.amanngirrbach.com/ids.
[3] =>
untitled
3Shape TRIOS
Perfected over five generations.
TRIOS® 3 Wired
TRIOS® 4
TRIOS® 5
The world’s most recognized intraoral scanners*
bring you industry-leading scanning experiences,
award-winning design, and unparalleled clinic-to-lab
workflows—powered by 3Shape Unite.”
Better for them.
Better for you.
Contact your reseller regarding availability
of 3Shape products in your region.
VISIT OUR BOOTH
Hall 4.2nd J098/K099
[4] =>
untitled
news
4
«1 – 3Shape
Bezogen auf den Wert der Plattform sagte 3Shape Unite-Nutzer
Dr. Simon Kold, Eigentümer des Herning Implant Center in Dänemark, dass
Unite es seiner Klinik ermöglicht habe,
an der Spitze zu bleiben, und dass der
Versuch, all die verschiedenen digitalen Technologien aufeinander abzustimmen, vor Unite eine Belastung für die
Ressourcen der Klinik gewesen sei.
3Shape CEO Jakob Just-Bomholt.
Letztes Jahr brachte 3Shape
TRIOS 5 auf den Markt, die neue Generation seines Flaggschiff-Intraoralscanners für Dentalpraxen. TRIOS 5
wurde für verbesserte Hygiene, Ergonomie auf höchstem Niveau und müheloses Scannen entwickelt.
In diesem Jahr setzt 3Shape seine
Mission fort, vernetzte, integrierte Lö-
«1 – Zircon Medical
Herr Waldner, sind Sie über diese Resultate der ersten Langzeitstudie zu
zweiteiligen Zirkonoxidimplantaten
überrascht?
Wir sind keineswegs überrascht,
denn wir sehen diese Resultate bei
unseren langjährigen Kunden schon
seit über 14 Jahren in der klinischen
Praxis. Aus diesem Grund haben wir
uns für einen Weg entschieden, der
heute nicht mehr so üblich ist: In Studien mit Langzeitdaten zu investieren, bevor das Produkt im Markt angeboten wird.
sungen bereitzustellen, die darauf
ausgelegt sind, die Arbeit von Zahnärztinnen und Zahnärzten zu optimieren. Auf der diesjährigen IDS stellt
3Shape seine Laborverwaltungssoftware 3Shape LMS und den brandneuen Laborscanner 3Shape F8 vor.
Laut 3Shape ist ein charakteristisches Merkmal aller neuen Produkte,
dass sie basierend auf direktem Input
von Dentalexperten entwickelt wurden und mit dem Ziel, Workflows zwischen Praxen und Laboren voranzutreiben und zu verbinden. Zusammen
dienen sie einem umfassenderen einzigen Zweck: der Verbesserung der
Patientenerfahrung.
Die Produkte von 3Shape verfügen über fortschrittliche Technologie,
die es Nutzerinnen und Nutzern ermöglicht, ihre Fähigkeiten, ihr Wissen, ihre Erfahrung und Kreativität
besser einzusetzen. Sie verbinden
Praxen mit Laboren, verbinden sich
nahtlos mit Software von Drittanbietern und verbinden Zahnärztinnen
und Zahnärzte mit ihren Kolleginnen
und Kollegen auf der ganzen Welt, sodass sie durch effiziente, verbesserte
und integrierte Workflows intelligenter arbeiten können.
„Jede 3Shape-Lösung ist das Ergebnis unserer Zusammenarbeit mit Zahnund Labortechnikern. Der 3Shape F8Scanner zum Beispiel war sechs
Jahre in der Entwicklung. Der Input
kam nicht nur von unseren Designern
und Ingenieuren, sondern auch von
den Labortechnikern selbst. 3Shape
hat Hunderte von Labormitarbeitern
auf der ganzen Welt befragt, um ge-
Warum war das für Sie wichtig?
Sowohl unsere Marktanalysen als
auch mehrere Review-Artikel haben
gezeigt, dass Komplikationsraten nach
der Fünf- beziehungsweise der AchtJahreslinie exponenziell ansteigen.
Aus diesem Grund war es uns wichtig, Studienergebnisse zum PatentImplantatsystem über diese Langzeitachse hinaus vorweisen zu können.
Am Ende des Tages definiert sich der
Preis für ein Medizinprodukt nicht
über dessen Herstellungskosten, sondern über seine vorhersagbaren, reproduzierbaren Langzeitresultate.
Was ist das Patent-System?
Das Patent-Implantatsystem wurde
mit dem Ziel entwickelt, mechanische und biologische Komplikationen
zu vermeiden. Um dies zu erreichen,
haben wir uns für ein Soft-TissueLevel-Design mit einem zementierten prothetischen Konzept entschieden. Die eingangs erwähnten Ergebnisse der Langzeitstudie geben dem
Erfolg des Patent-Konzepts recht.
3Shape TRIOS 5.
nau herauszufinden, vor welchen Herausforderungen sie stehen und mit
welchen Lösungen sie am besten Abhilfe schaffen können“, sagte Dr. Rune
Fisker, Vice President of Product Strategy bei 3Shape. Er fuhr fort: „Derselbe Ansatz wurde für den bahnbrechenden Intraoralscanner TRIOS 5,
für 3Shape LMS und für 3Shape
Unite verwendet. Sie alle sind Lösungen, die aus einer sinnvollen Zusammenarbeit hervorgehen, und sie
tragen dazu bei, die Standards der
Dentalindustrie zu erhöhen.“
Der Stand von 3Shape (J098/K099) befindet
sich in Halle 4.2. Lesen Sie mehr über die 3Shape
TRIOS-Intraoralscanner auf Seite 50.
«1– 3Shape
Commenting on its value, 3Shape
Unite user Dr Simon Kold, who owns
Die Neunjahresstudie belegt: Das PatentImplantatsystem stellt langfristige Mundgesundheit sicher. The nine-year study has shown that
the Patent dental implant system facilitates longterm oral health.
tige und künftige Implantatsysteme
messen lassen.
Die Studie mit dem Titel „Two-piece zirconia implants in the posterior mandible and
maxilla: A cohort study with a follow-up period
of 9 years“ wurde in der Dezember-Ausgabe von
Herning Implant Center in Denmark,
said that Unite had enabled his clinic
to stay ahead and that before Unite trying to align all the different digital
technologies had been a drain on the
clinic’s resources.
Last year, 3Shape released TRIOS 5,
the new generation of its flagship intra-oral scanner for dental practices.
TRIOS 5 was designed for improved
hygiene, next-level ergonomics and effortless scanning.
This year, 3Shape continues its
mission to provide truly connected, integrated solutions designed to optimise how dental professionals work.
At this year’s IDS, 3Shape is unveiling
its laboratory management software,
3Shape LMS, and the 3Shape F8 allnew laboratory scanner.
According to 3Shape, a distinctive
feature of all the new products is that
they were designed based on direct in-
put from dental experts and with the
goal of advancing and connecting dental workflows between clinics and laboratories. Together, they serve a broader
single purpose: to improve the patient
experience.
3Shape’s products feature advanced technology that allows users
to better use their skills, knowledge,
experience and creativity. They connect clinics with laboratories, seamlessly connect with third-party software and connect dental professionals
with their peers around the world, allowing dental professionals to work
smarter through efficient, enhanced
and integrated workflows.
“Every 3Shape solution is the result of us working together with dental
and lab technicians. The 3Shape F8
scanner, for example, was six years in
the making. It came not only from our
designers and engineers, but also from
lab technicians themselves. 3Shape interviewed hundreds of lab employees
around the world to find out exactly
what challenges they face, and what
solutions would best remedy them,”
said Dr Rune Fisker, 3Shape’s vice
president of product strategy.
He continued: “The same approach
was used for the groundbreaking
TRIOS 5 intra-oral scanner, for 3Shape
LMS and for 3Shape Unite. They are all
solutions that spring from meaningful
collaboration, and they help drive dental industry standards higher.”
The 3Shape booth (#J098/K099) is located
in Hall 4.2. Read more about the 3Shape TRIOS
intra-oral scanner portfolio on page 50.
before introducing the product to the
market.
healthy soft tissue and stable bone
levels after nine years.
Why was this important to you?
Our market analyses as well as
several review articles showed that
complication rates increase exponentially after five and eight years. Therefore, it was crucial for us to be able to
present study results on the Patent
dental implant system that extend beyond this period. Ultimately, the price
of a medical device is not determined
by its manufacturing costs but by its
ability to deliver predictable, reproducible long-term results.
Is zirconia better than titanium?
There are good and bad titanium
systems, just as there are good and
bad zirconia systems. Regardless of
the material, the crucial question is
how well does the system perform in
the long term—after eight years and
more—in the challenging environment
of the oral cavity? There are fundamental differences. Medicine is constantly evolving, which is why the demands of dentists and patients for
treatment success are also increasing.
Current and future implant systems
must perform in line with these higher
expectations of success.
What is the Patent system?
The Patent dental implant system
was developed with the specific aim of
avoiding mechanical and biological
complications. To accomplish this goal,
we opted for a soft-tissue-level design
and a cemented prosthetic concept.
The results of the long-term study
mentioned confirm the success of the
Patent concept: no peri-implantitis,
The study, titled “Two-piece zirconia implants in the posterior mandible and maxilla: A
cohort study with a follow-up period of 9 years”,
was published in the December issue of Clinical Oral Implants Research. Find out all about
the groundbreaking long-term study at the Patent booth (#D061) in Hall 10.1 at IDS.
Clinical Oral Implants Research veröffentlicht.
Zircon Medical CEO Marco Waldner und sein
Team sind in 12 europäischen Ländern aktiv
und arbeiten mit internationalen Partnern daran, Patent in implantologischen Praxen weltweit zu etablieren. Zircon Medical CEO Marco
Waldner and his team are active in 12 European
countries and are working on establishing
Patent in dental implant practices worldwide
together with international partners.
Ist Zirkonoxid besser als Titan?
Es gibt gute und schlechte Titansysteme, genauso wie es gute und
schlechte Zirkonoxidsysteme gibt.
Unabhängig vom Material ist doch
die entscheidende Frage: Wie performt
ein Implantatsystem langfristig – nach
mehr als acht Jahren – im schwierigen Umfeld der Mundhöhle? Hier sehen Sie fundamentale Unterschiede.
Die Medizin entwickelt sich ständig
weiter, weshalb auch der Anspruch
von Zahnärzten und Patienten an den
Behandlungserfolg steigt. An diesen
Erfolgserwartungen müssen sich heu-
Alles über die wegweisende Langzeitstudie erfahren Sie auf der IDS am Patent-Stand (D061)
in Halle 10.1.
«1– Zircon Medical
Mr Waldner, are you surprised by the
results of the first long-term study
on two-piece zirconia implants?
Not at all, as we have been seeing
these results in clinical practice with
our long-standing customers for over
14 years. As a result, we took a path
which is no longer common today: investing in studies with long-term data
Patent bei der IDS 2023: Das Zircon Medical-Team freut sich auf Ihren Besuch an Stand D061 in
Halle 10.1. Patent at IDS 2023: the Zircon Medical team is looking forward to your visit at Booth D061
in Hall 10.1.
40th International Dental Show 2023 • 14. März 14 March
[5] =>
untitled
[6] =>
untitled
news
6
Ivoclar stellt seinen High-End-Scanner PrograScan PS7 vor
Ivoclar presents its high-end PrograScan PS7 scanner
Der neue PrograScan PS7 wird ab Juni dieses Jahres verfügbar sein. The new PrograScan PS7 will be available from June.
1
100-jährigen Firmenjubiläums unterstrichen wird: „A Century of Innovation“.
„Wir wollen das Unternehmen
sein, das Einfachheit bietet“, sagte
Diego Gabathuler, CEO der Ivoclar
Gruppe, während der Pressekonferenz.
Für weitere Informationen über
PrograScan PS7 besuchen Sie den
Stand des Unternehmens auf der IDS
2023 (Halle 11.3, Stand A010/C019,
A011 und A020/C029).
2
1 Tobias Specht, Senior Director GBU Labside Digital, enthüllte den neue PrograScan PS7, der ab sofort vorbestellt werden kann. 1 Tobias Specht,
Senior Director GBU Labside Digital, unveiled the new PrograScan PS7, which can be pre-ordered now. 2 Von links/from left: Dr Laurent Schenk,
Senior Director Corporate Strategy; CEO Diego Gabathuler; CMO Patrick Frank; Tobias Specht, Senior Director GBU Labside Digital.
Der neue PrograScan PS7 ist
Ivoclars erster High-End-Laborscanner, der gleichzeitig Ober- und Unterkiefer scannen und innerhalb eines
einzigen vollautomatischen Vorgangs
zwei Modelle in 10 Sekunden erstellen kann. Der Scanner ermöglicht
Zahntechnikern ein schnelleres und
effizienteres Arbeiten und wurde
gestern auf der Pressekonferenz von
Ivoclar in Köln vorgestellt.
Der PrograScan PS7 ist mit zwei
Scan-Tellern, zwei optischen Lichteinheiten und acht Kameras ausgestat-
tet und erstellt Scans mit nur einem
Klick. Ein Scan von zwei Modellen
mit einer Genauigkeit von 5 μm dauert
nur 10 Sekunden. Der Scanner erkennt automatisch jegliches Zubehör
und benötigt 2 Minuten, um die digitalen Modelle in der Designsoftware
für die weitere Bearbeitung vorzubereiten. Im Vergleich zu sequenziellem
Scannen ergibt sich so ein deutlicher
Zeitgewinn um das rund Dreifache.
„Unser Ziel ist es, die menschliche Interaktion zu reduzieren und die Produktion zu beschleunigen“, kommen-
tierte Tobias Specht, Senior Director
der globalen Geschäftseinheiten von
Ivoclar.
Der PrograScan PS7 stimmt Technologie, Software und Materialien
aufeinander ab und lässt sich nahtlos
in die bewährten digitalen Workflows
von Ivoclar integrieren.
Mit der Einführung des neuen
PrograScan PS7 löst Ivoclar einmal
mehr sein Versprechen ein, innovative Produkte für den digitalen
Dental-Workflow zu liefern – eine Tatsache, die durch das Motto des
The new PrograScan PS7 is the
first high-end laboratory scanner
from Ivoclar that can simultaneously
capture upper and lower jaw models
in just 10 seconds in a fully automated, single process. The scanner
enables dental technicians to work
faster and with greater efficiency and
was presented to IDS attendees in Cologne yesterday during Ivoclar’s press
conference.
The PrograScan PS7 is equipped
with two scan tables, two optical light
units and eight cameras, and scans
start with just one click. A scan of two
models with an accuracy of 5 μm takes
just 10 seconds. The scanner automatically detects any accessories and
takes 2 minutes to prepare the digital
models in the design software for further processing. These scans are
approximately three times faster than
sequential scanning procedures and
thereby result in considerable timesaving. “Our objective is to reduce human interaction and speed up production,” commented Tobias Specht,
senior director of Ivoclar’s global business units.
The PrograScan PS7 aligns technology, software and materials, and it
integrates seamlessly with Ivoclar’s
proven digital workflows.
With the introduction of the new
PrograScan PS7, Ivoclar has once
again delivered on its promise to provide innovative products for digital
dental workflows—a fact that is underscored by the company’s 100-year anniversary theme: “A century of innovation”.
“We want to be the company that
provides simplicity,” Diego Gabathuler,
CEO of Ivoclar, said during the press
conference.
For more information on the
PrograScan PS7, stop by the company’s booth at IDS 2023 (Hall 11.3,
Booths A010/C019, A011 and A020/
C029).
AD
Dentistry Made Easier
With the Industry-Leading 3D Printer
Meet the Dental
Automation Ecosystem
Fully-Automated 3D Printer Fleets
For 24/7 Production
Explore how to reach new levels of speed and
productivity with all our latest dental innovations.
VISIT US AT:
HALL 3.1 , BOOTH J030 / K039
40th International Dental Show 2023 • 14. März 14 March
[7] =>
untitled
Photos: Marco Zanzottera, Laboratorio Odontotecnico ZR, Italy
TODAY LIVE
Tue - March 14
10:30 - 12:00
The aesthetical enhancement of monolithic
restorations in the 3rd dimension
12:30 - 13:30
:
Layering of anterior metal-based restoration
using composites with 2 different viscosities
14:00 - 15:00
The aesthetical enhancement of monolithic
restorations in the 3rd dimension
15:30 - 17:00
Hall 11.3
Stand C010
Structural and colour design of vitally
effective gingiva made of composite
[8] =>
untitled
interview
8
Mit edelweiss dentistry die optimale Integration von
Funktion und Ästhetik realisieren
Realising optimal integration of function and aesthetics
with edelweiss dentistry
Ein Interview mit Dr. Marco Tudts, edelweiss dentistry. An interview with Dr Marco Tudts, edelweiss dentistry.
Das österreichische Unternehmen
edelweiss dentistry stellt auf der
diesjährigen IDS seine innovativen,
ästhetischen Systemlösungen vor. In
diesem Interview erklärt Dr. Marco
Tudts, einer der wichtigsten Meinungsmacher des Unternehmens, die
Neuheiten des edelweiss dentistry
Produktportfolios und die Vorteile
des einzigartigen Hybridglasmaterials des Unternehmens.
endgültige Restauration nur mit einem Leinenschwabbel poliert werden, was die Ausarbeitung und Politur erheblich beschleunigt und keine
zusätzlichen Brenn- und Glasiergeräte
erfordert.
Als Teil des digitalen Workflows bietet edelweiss dentistry einen CAD/
CAM-Block für Implantate an. Was
sind seine Vorteile?
Dr. Marco Tudts ist Dozent an der Universität Gent in Belgien und unterhält eine Privatklinik mit
den Schwerpunkten Ästhetik und komplexe Rehabilitation. Dr Marco Tudts is a senior lecturer at
Ghent University in Belgium and maintains a private clinic with a focus on aesthetics and complex
rehabilitation. (© edelweiss dentistry)
Herr Dr. Tudts, auf der diesjährigen
IDS wird edelweiss dentistry den
neuen edelweiss CAD/CAM BLOCK
vorstellen. Können Sie uns mehr über
dieses Produkt erzählen?
Der edelweiss CAD/CAM BLOCK
ist unser neuestes Produkt und ein
echter Durchbruch in der CAD/CAM
Technologie. Die Einzigartigkeit des
edelweiss CAD/CAM BLOCKs liegt im
patentierten Herstellungsprozess, bei
dem durch Lasersintern und Verglasung ein hochmoderner Hybridglasblock hergestellt wird. Durch dieses
Verfahren werden die Materialeigenschaften stark verbessert.
Der Block hat die Ästhetik von
feldspathaltigem oder reinem Glas,
die Festigkeit von partikelinfiltrierter
Keramik und die Elastizität von hybriden Kompositblocks. Seine vielseitige Anwendbarkeit, in Kombination
mit den zeit- und kostensparenden
Verfahren, macht den edelweiss CAD/
CAM BLOCK zu einer echten Bereicherung für Zahnärzte, denen das
Wohl ihrer Patienten am Herzen liegt.
Der edelweiss CAD/CAM BLOCK
hat im Vergleich zu anderen auf dem
Markt befindlichen Blocks mehrere
Vorteile. Dank der glasähnlichen Eigenschaft des Materials muss die
Der edelweiss i-BLOCK ist einzigartig, weil wir erstmals einen CAD/
CAM-Block aus Hybridglas haben,
mit dem individuelle, direkt verschraubte Implantatkronen hergestellt werden können. Der neue
edelweiss i-BLOCK passt genau auf eine
Titanbasis (oder ähnliche Attachments), sodass die endgültige Restauration in derselben Sitzung eingesetzt
werden kann, was die Zahl der Behandlungssitzungen reduziert und das
Erlebnis des Patienten verbessert.
1
Darüber hinaus hat er eine einzigartige stoßdämpfende Wirkung.
Das Harz im Material verleiht der
Restauration die nötige Elastizität,
um jeder okklusalen Kraft standzuhalten. Dies ist besonders wichtig,
um die Übertragung von Kräften auf
das parodontale Gewebe, das Implantat, den Gegenzahn oder das Kiefergelenk zu vermeiden.
Die einzigartigen Eigenschaften
von i-BLOCK gewährleisten eine
hohe Ästhetik und außergewöhnliche Festigkeit mit lang anhaltender
Politur und Verschleißfestigkeit.
Das Elastizitätsmodul ähnelt dem
von Dentin, was diese Blocks zur
besten Wahl für die Sofortbelastung von Implantaten macht. Der
i-BLOCK lässt sich problemlos in
den digitalen Workflow der Praxis
integrieren.
Was ist das Besondere an den Restaurationssystemen von edelweiss
dentistry?
Wie bereits erwähnt, stellen wir
durch unser patentiertes Herstellungsverfahren ein einzigartiges Hybridglasmaterial her. Dieses Material,
welches eine solide Glasphase bildet,
hebt sich von anderen Materialien
auf dem Markt klar ab, da es die optischen Eigenschaften des natürlichen
Zahnschmelzes aufweist, was den daraus hergestellten Restaurationen
ein naturgetreues Aussehen verleiht.
Auch die physikalischen und mechanischen Eigenschaften sind verbessert. Seine Festigkeit ist ähnlich hoch
wie die von Lithiumdisilikat-Keramik.
Dies kommt dem Zahnarzt zugute, da
das Material ähnliche Eigenschaften
wie Keramik aufweist aber keine
aufwendige Zahnpräparation erforderlich ist. Unter Ausnutzung der ausgezeichneten Haftung an der Zahnsubstanz werden minimal oder nicht
präparierte Konstruktionen verwendet, die dem biomimetischen Prinzip
folgen, nur die verlorene Zahnsubstanz zu ersetzen und die gesunde
Zahnsubstanz zu erhalten. Dafür
steht edelweiss dentistry: die opti-
male Integration von Funktion und
Ästhetik.
Anmerkung der Redaktion: Besucher der IDS 2023 finden weitere
Informationen zu den Produkten
von edelweiss dentistry am Stand
des Unternehmens (D040/E041) in
Halle 11.3.
Austria-based company edelweiss
dentistry will be showcasing its innovative aesthetic solutions at
this year’s IDS. In this interview,
Dr Marco Tudts, one of the company’s key opinion leaders, explains
the newest additions to the edelweiss dentistry product portfolio and
the benefits of the company’s unique
hybrid glass material.
Dr Tudts, at this year’s IDS, edelweiss
dentistry will be presenting the
new edelweiss CAD/CAM BLOCK.
Could you tell us more about this
product?
The edelweiss CAD/CAM BLOCK
is our newest product and a true
breakthrough in CAD/CAM technology. The uniqueness of the edelweiss
CAD/CAM BLOCKs lies in the patented manufacturing process that
uses laser sintering and vitrification
to produce a state-of-the-art hybrid
glass block. As a result of this process, the material properties are
greatly enhanced.
The block has the aesthetics of
feldspathic or pure glass, the strength
of particle-infiltrated ceramics and
the resilience of hybrid composite
blocks. Its versatile application, in
combination with its time- and costsaving procedures, makes the edelweiss CAD/CAM BLOCK a real asset
for dental professionals who have
their patients’ best interests at heart.
The edelweiss CAD/CAM BLOCK
has several advantages compared
with other blocks currently on the
market. Owing to the material’s glasslike property, the final restoration
only needs to be polished with a linen
buff, which significantly speeds up
2
1 Der neue edelweiss i-BLOCK. 2 Das DIRECT VENEERs und OCCLUSIONVD-System von edelweiss.
1 The new edelweiss i-BLOCK. 2 The edelweiss DIRECT VENEERs and OCCLUSIONVD system.
40th International Dental Show 2023 • 14. März 14 March
finishing and polishing, and does not
require additional firing and glazing
equipment.
As part of the digital workflow,
edelweiss dentistry offers an implant CAD/CAM block. What are its
advantages?
The edelweiss i-BLOCK is unique
because for the first time we have a
hybrid glass CAD/CAM block that
can be used to create customised directly screw-retained implant crowns.
The new edelweiss i-BLOCK fits precisely on a titanium base (or similar
attachments) so that the final restoration can be placed in the same appointment, reducing treatment sessions and improving the patient
experience.
In addition, it has a unique shockabsorbing effect. Resin within the material provides resilience to the restoration to withstand any occlusal
force. This is particularly important
to avoid transmission of force to the
periodontal tissue, the implant, the
opposing tooth or the temporomandibular joint.
The unique properties of the
i-BLOCK ensure high aesthetics and
exceptional strength with long-lasting polish and wear resistance. The
modulus of elasticity is similar to
that of dentine, making these blocks
the best choice for immediate loading
procedures on implants, and the
i-BLOCK can easily be integrated into
the practice’s digital workflow.
What is unique about edelweiss
dentistry’s restorative systems?
As mentioned before, through
our patented manufacturing process,
we produce a unique hybrid glass
material. Being in a solid glass phase,
this material stands out from other
materials on the market, as it has the
optical properties of natural enamel,
giving the restorations made from it
a lifelike appearance. The physical
and mechanical properties are also
improved. Its strength is now similar
to that of lithium disilicate ceramics.
This benefits the clinician in that the
material has properties similar to
those of ceramics and does not require extensive tooth preparation.
Making use of its excellent adhesion
to the tooth structure, minimal or
non-preparation designs are used following biomimetic principles of replacing only lost tooth structure and
preserving the healthy tooth structure. This is what edelweiss dentistry
stands for: the optimal integration of
function and aesthetics.
Editorial note: Visitors to IDS 2023
can find more information on the
edelweiss dentistry products at the
company’s booth (#D040/E041) in
Hall 11.3.
[9] =>
untitled
[10] =>
untitled
interview
10
Fachhändler setzt auf Weitsicht und Regionalität
Retailer focuses on further development and regional markets
Ein Interview mit Jörg Linneweh, Geschäftsführer bei dental bauer.
An interview with Jörg Linneweh, general manager of dental bauer.
Nach der erfolgreichen Übernahme
des Unternehmens Pluradent durch
die dental bauer Gruppe nutzt das
Team die IDS 2023, um Geschäftsfelder zu pflegen, weiterzuentwickeln
und künftige Allianzen zu bilden.
Neben der Kernkompetenz als Vollsortimenter präsentiert sich die
dental bauer Gruppe zur IDS auch als
verlässlicher Logistikdienstleister –
mit GLS Logistik als europaweit bekannte Größe im Dentalhandel. Inwieweit profitieren Zahnarztpraxen
und Dentallabore von dieser Übernahme?
Das Zentrallager der GLS bietet
dental bauer und unserer Firmengruppe eine deutliche Verbesserung
gegenüber der bisherigen Lösung. Da
es sich nun um unser eigenes Logistikunternehmen handelt, können
wir die Prozesse wie preisoptimierten
Einkauf, Verfügbarkeit der Produkte
und die Versandwege selbst steuern
und damit passgenau gestalten. Diese
Eigenständigkeit schafft für uns und
unsere Kunden die längst überfällige
Erleichterung sämtlicher Abläufe
und eine wirtschaftliche Verbesserung. Zusätzlich sind wir ab jetzt in
der Lage, die Umsetzung für eine
nachhaltige Ausrichtung aller Bereiche selbst in die Hand zu nehmen. Jeder Teilnehmer unserer Belieferungskette profitiert von diesen wichtigen
Parametern, der Preisattraktivität,
dem sofort abrufbaren Vollsortiment
und dem zeitgemäßen Zustellservice.
Worauf liegt der regionale und inhaltliche Fokus der Unternehmensgruppe?
Die Aktivitäten der dental bauer
Gruppe konzentrieren sich derzeit
auf die D-A-CH-Region und die Nieder-
After the acquisition of Pluradent,
dental bauer is focusing on maintaining and expanding its business ventures while building new partnerships
during IDS 2023.
Jörg Linneweh (links), Geschäftsführer bei dental bauer, im Gespräch mit Lutz Hiller, Mitglied
des Vorstands der OEMUS MEDIA AG. Jörg Linneweh (left), generalgeneral manager of dental
bauer, in discussion with Lutz Hiller, a member of the board of OEMUS MEDIA AG.
lande. Unsere ausgeprägten Sparten
als dentaler Dienstleister und Handel, das Vollsortiment mit zusätzlichen Exklusiv- und Eigenmarken, in
Verbindung mit unserem Logistikcen-
AD
Experience Quality
Silicones
Light Curing Resin
Disinfection
YEARS
We are experts in:
OVER
Be part of the design process!
High Quality Products
Made in Lindlar,
Germany
Visit us
Hall 4.2
H090/I091
ter GLS bieten alle Voraussetzungen,
um uns mit schnellem Schritt im nationalen und internationalen Markt
fortzubewegen. Wir setzen seit Jahrzehnten auf den Begriff Weiterentwicklung und sind mehr denn je offen
für kreative Denkmodelle mit soliden
Lösungen. Das „out-of-the-box thinking“
lässt sich in jede Sprache übersetzen
und gleichwohl praktizieren. Für konservatives Denken ist Europa zu klein
und die Datenleitungen zu schnell.
Die Zukunft lehrt uns schon heute,
den Blick auf länderübergreifende
Konzepte zu richten.
Was zeichnet Ihre neue Eigenmarke
PLULINE aus?
Im Vergleich zu namhaften
Brands verstehen wir uns als frischer
Anbieter einer individuellen Marke,
verbunden mit unserem bekannten
Anspruch auf Prime Quality. Unsere
Zielgruppen sind Anwender in Praxen und Labors, die das Individuelle
schätzen und dabei ihr Vertrauen unserer Kompetenz schenken. Das
PLULINE-Sortiment basiert auf unserer einzigartigen Erfahrung und orientiert sich am täglichen Bedarf. Wir
können gezielt Einfluss auf die Produktqualität nehmen. Kurze Entscheidungswege bieten uns die Möglichkeit, das Sortiment sinnvoll
anzupassen – gezielte Anregungen
von Anwendern sind daher stets willkommen. Bei all unseren Entscheidungen genießt der Begriff Nachhaltigkeit hohen Stellenwert. Trotz
vollumfänglicher Leistungen sind wir
höchst wettbewerbsfähig. PLULINE
wird zunehmend international ausgerichtet und steht im Moment exklusiv den Unternehmen der dental
bauer Gruppe als Ergänzung des Sortiments zur Verfügung. Mit PLULINE
möchten wir für einen frischen Wind
sorgen.
„Mit PLULINE möchten
wir für einen frischen
Wind sorgen.“
IDS-Besucher können sich am Stand E050/H080
in Halle 10.1 über die dental bauer Gruppe informieren.
Let us talk about New Opportunities!
Müller-Omicron GmbH & Co. KG · Germany
Phone: +49 (0) 2266 47420 · info@mueller-omicron.de
www.mueller-omicron.com
In addition to being a full-range supplier, the dental bauer group is introducing itself as a reliable logistics
service provider at IDS, having acquired the well-known dental trade
branch of GLS Logistik. How can
dental practices and laboratories
benefit from this?
The GLS central warehouse offers
dental bauer and our group of companies a significant improvement over
the previous solution. As it is now our
own logistics company, we can control
all processes, such as optimal price
points, product availability and shipping routes, and adapt them individually. This independence facilitates all
processes for us and our customers
and brings economic advantages. In
addition, it allows us to implement
measures for sustainability in all areas. Every participant in our supply
chain benefits from these important
parameters, the attractive prices, the
immediately available of our full range
of products and the up-to-date delivery
service.
Which topics and regional markets is
dental bauer focusing on?
Our activities are currently concentrated on the Germany, Austria
and Switzerland region and on the
Netherlands. Our well-established divisions as a dental service provider
and distributor and the complete
range of products, including exclusive and proprietary brands, in conjunction with our GLS logistics centre, allow us to move quickly in the
national and international markets.
For decades, we have been focusing
on means to achieve our further development and are more open than
ever to creative thinking models with
solid solutions. With our widely applicable out-of-the-box thinking, we
are expanding beyond Europe, supported by the ongoing rapid data and
technological advancements. It’s clear
that focus on cross-border concepts
is the future.
What are the distinguishing features
of your new PLULINE brand?
Compared with well-known
brands, we see ourselves as a provider of a fresh, individual brand, in
combination with our quality standards. Our target groups are users in
practices and laboratories who appreciate our individual solutions
and trust our competencies. The
PLULINE range builds on our unique
experience and is focused on daily
practice needs. As we can directly
influence the product quality and
thanks to short decision-making
paths, we are able to adapt the range
reasonably. Targeted suggestions
from users are therefore always welcome. Sustainability is crucial to all
[11] =>
untitled
Sca
an me
zum Pro
oblem
m
Unnütze Biofilmremovings, Stillstand der Einheiten und hohe Reparaturkosten bis zu 10.000 € p.a.
verursachen Dir Wasserschmerzen. Komplexe Wasser-Hygieneprobleme und nicht mehr verkehrsfähige Desinfektionsmittel im Bereich Trinkwasser, Abwasser, Prozesswasser und Medizinprodukte
gefährden Deinen Praxisbetrieb.
„Erfolgreiche Problemlösung heißt
zunächst Problemverständnis. Wir
haben 13 Hygieneprobleme identifiziert
und allein 5 davon betreffen jede
zahnmedizinische Einrichtung in
Deutschland. Diese Probleme sind schnell
lösbar.“
Jan Papenbrock
Geschäftsführer & Co-Gründer BLUE SAFETY GmbH
SAFEDENTAL löst Wasserschmerzen. Unser
Hygienesystem tausendfach erfolgreich umgesetzt.
Scan me
zur Lösung
Für die nachhaltige Lösung Deiner Wasser-Hygieneprobleme haben wir patentierte Technologien,
Medizinprodukte und Lösungsstrategien entwickelt. Wir sind Dein Ansprechpartner für alle Fragen
rund um Hygiene. Weniger technische Störungen, Ausfall, geringere Reparturkosten und ein einfaches
System sind das Ergebnis.
„Die 12-jährige Expertise unserer BLUE
SAFETY GmbH löst mit dem SAFEDENTAL
System Deine Wasser-Hygieneprobleme
aus rechtlicher, technischer, wissenschaftlicher und wirtschaftlicher Sicht.“
Jan Papenbrock
Geschäftsführer & Co-Gründer BLUE SAFETY GmbH
Online www.bluesafety.com/SAFEDENTAL
WhatsApp 0171 991 00 18
Fon 0251 92 77 85 4-0
BLUE SAFETY auf der IDS in Köln.
Innovations-Halle 2.2
Stand A 30 + B 49
Scan me
zum Erstgespräch
[12] =>
untitled
AD
12
Diamondexperts
since 1996
interview
our decisions. Despite the comprehensiveness of our services, we are
highly competitive in all areas. PLULINE is increasingly expanding into
international markets and is currently exclusively available to dental
bauer group members. Our aim with
PLULINE is to provide a breath of
fresh air.
“Our aim with
PLULINE is to provide
a breath of fresh air.”
IDS visitors can learn more about the dental
bauer group at Booth E050/H080 in Hall 10.1.
Neues vom DTI-Netzwerk
News from the DTI network
Herausgeber treffen sich vor der IDS.
Publishers meet prior to IDS.
Halle 11.2
Stand L008
Vor der IDS 2023 kamen fast 40 Partner der Dental Tribune International-Verlagsgruppe für das
Annual Publishers’ Meeting zusammen. Ahead of IDS 2023, about 40 partners of the Dental
Tribune International publishing group got together for their Annual Publishers’ Meeting in Cologne
in Germany.
Vielfalt für
Praxis und Labor
über 1.500 verschiedene
Diamantschleifinstrumente
in 60 Grundformen
bis zu 6 Körnungen
und 14 Durchmessern
Qualität made in Germany
Unsere Unimatrixdiamantierung garantiert
exzellenten Rundlauf, ein perfektes Schliffbild
und lange Lebensdauer.
Besuchen Sie unseren
Onlineshop auf www.nti.de
NTI-Kahla GmbH • Rotary Dental Instruments
Im Camisch 3 • D-07768 Kahla/Germany
Tel. 036424-573-0
E-mail: verkauf@nti.de • www.nti.de
Im Vorfeld der 40. IDS veran
staltete Dental Tribune International (DTI) am 11. März sein Annual
Publishers’ Meeting. Verleger aus
13 verschiedenen Ländern kamen
zusammen, um den aktuellen Stand
des Netzwerks und eine Reihe neuer
Projekte für das kommende Jahr sowie strategische Ansätze für die Zukunft zu diskutieren.
Bei dem Treffen ging DTI-Geschäftsführer Torsten Oemus auf die
Herausforderungen ein, vor denen
die Zahnmedizin in den letzten Jahren aufgrund der Auswirkungen der
COVID-19-Pandemie stand. Er sagte
auch, dass die Haupttrends im sich
erholenden Geschäft heute Digitalisierung, Spezialisierung und Konsolidierung seien. Als Reaktion
darauf hatte DTI sein Portfolio bereits vor der Pandemie angepasst,
indem es den Fokus auf digitale
Medienprodukte und digitale Lernangebote für den Dentalbereich ausgeweitet hatte. Darüber hinaus
fügte DTI 2022 seinem PremiumPrintportfolio neue Publikationen
und Websites hinzu, die sich auf
3D-Druck in der Zahnheilkunde und
die Behandlung mit transparenten
Alignern konzentrieren, und stärkt
seine regionalen Aktivitäten. „In Zeiten multipler Krisen ist das gemeinsame Ziel aller Partner der Aufbau eines nachhaltigen Portfolios“, ergänzte
Oemus.
Das Treffen bot auch die Gelegenheit für eine Ankündigung über
die Expansion von DTI in die neuen
Märkte, darunter Vietnam und Portugal. „Wir freuen uns darauf, unsere internationale Präsenz auszubauen und in Zukunft jeden Winkel
der Welt abzudecken“, sagte Dr. Björn
Kempe, Gründer und CEO von Expos Asia, der auch als Berater für
DTI tätig ist.
Ahead of the 40th IDS, Dental
Tribune International (DTI) held
its Annual Publishers’ Meeting on
11 March. Publishers from 13 different countries gathered in Cologne to
discuss the current state of the network and a number of new projects for
the upcoming year, as well as strategic
approaches for the future.
At the meeting, DTI CEO Torsten
Oemus addressed the challenges that
dentistry has faced over the past
years, owing to the affects of the
COVID-19 pandemic. He also said that,
as the dental business recovers, the
main trends in the industry are clearly
digitalisation, specialisation and consolidation. DTI had already adapted its
portfolio by extending its focus on digital media products and digital learning opportunities for dentists even
before the pandemic hit. In 2022, DTI
continued to respond to these trends
by adding new publications and websites focusing on 3D-printing in dentistry and clear aligner treatment to
its premium print portfolio, and by
strengthening its regional operations.
“In times of multiple crises, the common goal of all partners is to build a
sustainable portfolio,” Oemus emphasised.
The meeting also provided an opportunity for an announcement about
DTI’s expansion into new markets,
including Vietnam and Portugal. “We
look forward to expanding our international presence and covering every
corner of the world in the future,” said
Dr Björn Kempe, founder and CEO of
Expos Asia and consultant for DTI.
[13] =>
untitled
¡êƎơśĔƎƕȿ
ĸśȿĔLJćĔŐŐĔśćĔȡȿ
½śĸơĔĎȿ
ĆLjȿƕřĸŐĔƕȡ
ŐĔêƎ ŧƎƎĔćơɶȜȿơĴĔȿ«ơƎêƨřêśśȿ
EƎŧƨƋȽƕȿǗêĭƕĴĸƋȿŧƎơĴŧĎŧśơĸćȿ
ĆƎêśĎȜȿĸƕȿĔLJćĸơĔĎȿơŧȿêśśŧƨśćĔȿ
śĔǂȿƋƎŧĎƨćơƕȿêśĎȿĬĔêơƨƎĔƕȿ
ŐêƨśćĴĸśĭȿêơȿQ%«ȜȿĴĔŐƋĸśĭȿĎŧćơŧƎƕȿ
ơƎĔêơȿřŧƎĔȿćŧřƋŐĔLJȿćêƕĔƕȿǂĸơĴȿ
śĔǂȿćŐĸśĸćêŐȿĬĔêơƨƎĔƕȜȿêśȿĸřƋƎŧǁĔĎȿ
ĎĸĭĸơêŐȿǂŧƎōǗŧǂȜȿêĎĎĔĎȿƕƨƋƋŧƎơȜȿ
êśĎȿơƎĔêơřĔśơȿƋŐêśśĸśĭȿƕĔƎǁĸćĔƕȡˀ
ÕĸƕĸơȿơĴĔřȿêơȿơĴĔȿ«ơƎêƨřêśśȿĆŧŧơĴȿ
ȯMêŐŐȿǟȡǝȿɺȿ«ơêśĎȿEȳǛǣǛȿbȳǛǣǤȰȿ
ćŐĔêƎćŧƎƎĔćơȡćŧř
Acc.1247_en_A_01
[14] =>
untitled
news
14
Impressionen des Vor-IDS-Tages Impressions from the pre-IDS day
1
2
3
4
5
1 Der Empfang des Verbandes der Deutschen Dental-Industrie (VDDI) fand am Montagabend im Flora Köln statt. 1 The reception of the Association of the German Dental Industry(VDDI) took place on Moday evening at the Flora Cologne 2 VDDIVorstandsvorsitzender Mark Stephen Pace begrüßte die Gäste der IDS 2023. 2 VDDI Chairman of the Board Mark Stephen Pace welcomed the guests of IDS 2023. 3 Planmeca stellt auf der IDS 2023 seine Software-Plattform Romexis vor.
3 Planmeca is presenting its software platform Romexis at IDS 2023. 4 Heikki Kyöstilä, Präsident und Gründer von Planmeca, begrüßt die Teilnehmenden der gemeinsamen Presseveranstaltung von Planmeca und KaVo Dental. 4 Heikki Kyöstilä, president and founder of Planmeca welcomes attendees to the press event of Planmeca and KaVo Dental. 5 Dr. Martin Rickert, Geschäftsführer von KaVo Dental, sprach über neue Produkte, die Planmeca und KaVo Dental Seite an Seite auf der IDS präsentieren.
5 Dr Martin Rickert, CEO of KaVo Dental, spoke about product innovations that Planmeca and KaVo Dental will present side by side at IDS.
AD
ș '/VU]KXKJYSUUZNGTJVXKIOYKYIGTK^VKXOKTIK
ș 9ZGHRKXKGRZOSKJGZGZXGTYLKX=/,/ ZKINTURUM_
ș +^ZKTJKJHGZZKX_ROLKGTJYIGTTKXHGYKYZGTJH_INGXMOTM
ș ,GYZYIGTZOVNKGZOTMGTJYIGTJGZGVUYZVXUIKYYOTM
ș
[15] =>
untitled
Entwickelt für eine
perfekte Hygiene
Besuchen Sie uns
auf der IDS 2023:
Halle 11.1 | Stand G010 H019
Abnehmbare Griffe
Instrumenten-
und Abdeckung
Reinigungssystem
SaugschlauchReinigungssystem
Autoklavierbare
Köchereinsätze
Partner von:
TAKARA C OMPANY E UROPE GMBH
Berner Straße 18 · 60437 Frankfurt am Main
Tel. +49 (0) 69 50 68 78-0 · Fax +49 (0) 69 50 68 78-20
E-Mail: info@takara-belmont.de
Internet: www.belmontdental.de
[16] =>
untitled
[17] =>
untitled
NEW
Your NEW dentine restoration system
All Biodentine’s science
with the e
erience
you expect
Visit us Hall 11.1
Biodentine XP Medical Device Class III awaiting CE marking.
The information contained in this support is intended for the international public of health professionals
attending IDS 2023 and is not specifically intended for health professionals practicing in Germany, who
are therefore not subject to the obligation of compliance to the German law relating to the advertising
of medical devices.
[18] =>
untitled
industry
18
NTI-KAHLA: DIAMOND EXPERTS SINCE 1996
Wir sind seit 27 Jahren Experten
für die Entwicklung und Herstellung von rotierenden Instrumenten.
Durch unsere innovativen Produktions- und Diamantierungsverfahren erhalten Sie bei NTI-Kahla die
hochwertigsten Instrumente für
Ihre Zahnarztpraxis oder Ihr Dentallabor. Unser umfangreiches Sortiment an Diamantschleifern mit
60 Grundformen, in bis zu sechs
Körnungen und bis zu 14 Durchmessern, deckt alle erdenklichen
Anwendungen ab. Besonders unsere innovativen Lösungen zur Bearbeitung von Zirkondioxid sowie
von Hohlkehl- und Inlaypräparationen erleichtern den Arbeitsalltag
von Behandlern und Technikern
erheblich. In unserem Sortiment
finden Sie darüber hinaus exzellente Polierer für alle Dentalmaterialien, Hartmetallfräser, Hartmetallbohrer, Kronentrenner für Zirkondioxid und Metalle, chirurgische
Instrumente, Instrumente für die
Kieferorthopädie und vieles mehr.
Sie möchten mehr erfahren?
Besuchen Sie uns auf der Internationalen Dental-Schau in Halle
11.2 am Stand L008 und nutzen Sie
direkt Ihren persönlichen IDS-Gutschein: Der Gutschein in Höhe von
25 Euro ist vom 14. bis 18. März
2023 gegen Vorlage auf unserem
IDS-Messestand und ab einem Warenwert von 150 Euro einlösbar.
Sie sind nicht auf der IDS?
Kein Problem!
PANAVIA WIRD 40: EINE GESCHICHTE KONTINUIERLICHER INNOVATION
FORTY YEARS OF PANAVIA: A STORY OF CONTINUOUS INNOVATION
1983, vor genau 40 Jahren, führte
Kuraray PANAVIA EX, das erste
Produkt der PANAVIA-Familie, ein.
Seitdem wurde das Portfolio durch
die Kombination von ursprünglich
bereits eingesetzten mit neu entwickelten Technologien kontinuierlich weiterentwickelt. Daraus entstand schließlich das heutige
Produktportfolio mit seinen einfach
anwendbaren und hochästhetischen
Befestigungskompositen, die eine
ausgezeichnete Haftfestigkeit bieten.
Das neueste Produkt der
PANAVIA-Familie ist PANAVIA Veneer LC, ein lichthärtendes Befestigungssystem von Kuraray Noritake
Dental, das in vier Farben erhältlich
ist. Aufgrund einer langen Verarbei-
tungszeit von 200 Sekunden (bei
Umgebungslicht von 8.000 Lux) ist
PANAVIA Veneer LC für Fälle prädestiniert, in denen mehrere Veneers gleichzeitig befestigt werden.
Zu den Produktvorteilen gehören
eine optimal eingestellte Viskosität
der Pasten sowie Konsistenz für eine
einfache Materialausgabe und Positionierung der Veneers. Außerdem
bietet das System eine hohe Farbstabilität für dauerhaft ästhetische
Ergebnisse, eine einfache Überschussentfernung nach kurzer Aushärtung
und eine langfristig hohe Haftfestigkeit.
In 1983, exactly 40 years ago,
Kuraray introduced PANAVIA EX, the
first product of the PANAVIA family.
Wir freuen uns auf Ihren Anruf
unter der Telefonnummer +49 36424
5730 oder Ihre E-Mail an verkauf@
nti.de. Nutzen Sie ebenfalls unseren
Onlineshop unter www.nti.de. Hier
finden Sie neben allen Produkten
und Preisen nützliche Funktionen,
welche Ihren Bestellvorgang und
die Verwaltung erleichtern.
NTI-Kahla, Germany
www.nti.de
Hall 11.2, Booth L008
AD
40th International Dental Show 2023 • 14. März 14 March
Since then, the company has continued to advance the portfolio by combining technologies used from the
beginning with newly developed
ones. These developmental efforts ultimately resulted in the current portfolio of easy-to-use and highly aesthetic resin cements that provide
top-level bond strength.
The latest member of the
PANAVIA family is PANAVIA Veneer
LC, a light-polymerised resin cement
system from Kuraray Noritake Dental, which is available in four shades.
With its extended working time of
200 seconds (under ambient light of
8,000 lux) on the primer, PANAVIA
Veneer LC is predestined for a simultaneous veneer placement technique.
Beneficial features include wellaligned paste viscosity and consistency for easy dispensing and placement, high colour stability for
long-lasting aesthetics, easy excess
removal after short initial polymerising and excellent bond strength over
time.
Kuraray Noritake
Dental, Japan
www.kuraraynoritake.eu
Hall 11.3
Booth E010/F019
[19] =>
untitled
[20] =>
untitled
industry
20
RAPID SHAPE STEHT FÜR AUTOMATISIERUNG IM 3D-DRUCK
RAPID SHAPE STANDS FOR AUTOMATED 3D PRINTING
Die additive Fertigung ist ideal für die Herstellung
von Kunststoffmodellen für zahnmedizinische Indikationen. Dazu gehören ein hocheffi zientes 3D-RapidPrototyping und die Fertigung mit ultrafeiner Auflösung.
Rapid Shape nutzt für seine 3D-Drucker das Digital Light Processing, weil nur mit dieser Technologie
hochauflösende Teile über eine lange Zeit wiederholgenau gedruckt werden können.
Bei der Entwicklung seiner 3D-Drucker denkt
Rapid Shape in allen Dimensionen. Der Anwender
kann je nach Bedarf das kleine Modell D20+, das
kompakte Modell D30+ oder den vollautomatischen
3D-Drucker D50+ wählen. Am Ende erhält er perfekt
aufeinander abgestimmte Lösungen für einen optimalen Workflow.
Mit einem großen Volumen und der automatischen Abtrenneinheit des 3D-Druckers D50+ können
Anwender ihre täglichen Stückzahlen in neue Dimensionen katapultieren. Druckteile werden von der Bauplattform automatisch getrennt und in einem Korb
gesammelt. Der nächste Druckauftrag wird umgehend
gestartet.
Auf der IDS präsentiert Rapid Shape den
3D-Drucker D50+. Das Team ist gern bereit, Interessierten die zahlreichen Highlights des Gerätes vorzustellen. Einfach vorbeischauen!
Additive manufacturing is the ideal choice for producing plastic models for dental indications. This process
requires highly efficient rapid prototyping and manufacturing with an ultrafine resolution. Rapid Shape’s 3D
printers employ digital light processing because this is
the only technology that can be used to print high-resolution parts over a long period with repeat precision.
Rapid Shape thinks of everything when developing its 3D printers. Users can choose from a range of
printers, such as the small D20+ model, the compact
D30+ model and the fully automated D50+ 3D printer,
depending on their needs. We deliver perfectly coordinated solutions to ensure an optimal workflow.
The large volume and automatic separating unit of
the D50+ 3D printer allow users to catapult their daily
output quantities into new dimensions of production.
Printed parts are separated automatically from the
build platform and collected in a basket. The next print
order is then started quickly.
Rapid Shape will be presenting the D50+ 3D printer
at IDS. The team is looking forward to introducing prospective customers to all of the highlights the device
offers. Please come by!
Rapid Shape, Germany
www.rapidshape.de
Hall 4.2, Booth K089
EDENTA PRÄSENTIERT WHITETIGER DIAMANTENINSTRUMENTE – NEU MIT VERGOLDETEM SCHAFT
EDENTA PRESENTS WHITETIGER DIAMOND
INSTRUMENTS—NOW WITH GOLD-PLATED SHANKS
Edenta stellt auf der IDS 2023 die
WhiteTIGER-Diamantinstrumente mit
vergoldetem Schaft vor. Damit lassen
sich die hochwertigen Diamantinstrumente sehr leicht von herkömmlichen
Diamantinstrumenten unterscheiden.
Eine Spezialbindung bindet die Multilayer-Diamantkörner sicher ein. Eine
zusätzliche, verschleißfeste Beschichtung gewährleistet eine verbesserte
Standzeit sowie eine erhöhte Abtragsleistung gegenüber herkömmlichen
Diamantinstrumenten. Damit sorgt
WhiteTIGER für eine schonende Behandlung. Die Multilayer-Diamantstruktur sorgt für schnellen und effektiven Materialabtrag. Die Beschichtung
reduziert das Zusetzen der Spanräume
und senkt damit die Wärmeentwicklung. Die speziell für die Kronenstumpf- und Kavitätenpräparation
konzipierten Instrumente weisen gegenüber herkömmlichen Diamantinstrumenten eine höhere Abtragsleistung und bessere Kühlung auf und
liefern ein effi zientes und optimales
Präparationsergebnis.
At IDS 2023, Edenta is presenting its
WhiteTIGER diamond instruments with
AD
40th International Dental Show 2023 • 14. März 14 March
gold-plated shanks. This new feature
makes it very easy to distinguish the
high-quality WhiteTIGER diamond instruments from conventional diamond
instruments. A special bond securely
binds the multilayer diamond particles.
The wear-resistant coating ensures an
improved service life as well as increased abrasion performance compared with conventional diamond instruments. WhiteTIGER diamond
instruments thus enable gentle treatment. The multilayer diamond structure
ensures fast and effective material abrasion. The coating reduces clogging of
the chip spaces and thus lowers heat
generation. Specifically designed for
crown abutment and cavity preparation, the instruments have an increased
abrasion rate and better cooling compared with conventional instruments,
delivering the optimal preparation result efficiently and gently.
Edenta Etablissement,
Liechtenstein
www.edenta.com
Hall 11.3
Booth A060/B069
[21] =>
untitled
Tired of repair and repeat?
Don’t enter the vicious cycle, use our MI solutions
3 Identify risk areas
3 Increase patient compliance
Ó
Prevent with
GC MI Paste Plus / GC Tooth Mousse
3 Prevent caries in synergy with fluoride
3 Supply bio-available minerals
Î
GC Tri Plaque ID Gel
Three-tone plaque disclosing gel
GC MI Paste Plus/
GC Tooth Mousse
Bio-available calcium and phosphate,
with/without fluoride
Restore with
EQUIA Forte HT
3 Simple, minimally
invasive procedure
3 Cost-effective and
durable
EQUIA Forte HT
Bulk fill glass hybrid
long-term restorative system
Solved with GC!
)%'7412'08
KPHQIEG"IEFGPVCN
JVVRU GWTQRGIEFGPVCNGP)$
2KEVWTGU EQWTVGU[QH&T24QWCU(TCPEG &T&/CJQP[#WUVTCNKC CPF&T<$KNIG-ØVØM
£
Identify with
GC Tri Plaque ID Gel
[22] =>
untitled
industry
22
BOREA STELLT NEUEN FARBTONSCANNER RAYPLICKER COBRA VOR
BOREA INTRODUCES NEW SPECTROPHOTOMETER, THE RAYPLICKER COBRA
Rayplicker Cobra bietet eine objektive, zuverlässige und reproduzierbare Farbanalyse von Zähnen auf
der Grundlage der Spektralfotometrie-Technologie. Die Zahnfarbe
wird nach dem CIE-Normfarbsystem analysiert und unter verschiedenen Farbzuordnungsreferenzen angezeigt: Gesamtfarbton, drei Teile,
neun Teile und eine detaillierte Zuordnung. Diese Lösung bietet innovative ergonomische Eigenschaften.
Das Gerät ist mit einem miniaturisierten Messkopf ausgestattet, der
den Zugang zu allen Zähnen erleichtert. Die autoklavierbaren Kalibrierungsspitzen bieten eine Selbstkalibrierung des Geräts und schützen
vor Kreuzkontaminationen. Der OLED-
Touchscreen führt Benutzerinnen
und Benutzer durch die Farbaufnahme und die WLAN-Übertragung
des Live-Videos auf dem Computerbildschirm. Dies ermöglicht eine
verbesserte Patientenkommunikation.
In Kombination mit der kostenlosen Rayplicker Vision-Software ermöglicht das Spektralfotometer die
Durchführung von Farb- und Transluzenz-Analysen eines Zahns. Auch
die Bewertung von Bleaching-Behandlungen wird dadurch einfach.
Die Nutzerinnen und Nutzer profitieren außerdem von einem kostenlosen Zugang zur Borea ConnectPlattform, die über einen Webbrowser zugänglich ist. Dieses Tool opti-
miert die Verwaltung und Echtzeitüberwachung von Aufträgen und
gewährleistet eine einfache und
schnelle Übermittlung der für die
ordnungsgemäße Herstellung der
Prothesen erforderlichen Daten. Zu
diesen Daten gehören Farbtöne, Patientenfotos und digitale Abdrücke.
Der neue Rayplicker Cobra bietet eine vollständige und innovative
Lösung für die Kommunikation zwischen Praxis und Labor. Er reduziert
den Ausschuss im Zusammenhang
mit Farbproblemen und bringt echten Komfort und Zeitersparnis bei
der täglichen Arbeit. Zusätzlich verbessert er die Kommunikation mit
Patientinnen und Patienten.
Durch das einfache Ablesen der
CIE-Werte ist der Rayplicker Cobra
kompatibel mit der Anwendung für
persönliche Mischrezepte für Zahntechniker und damit ein revolutionäres und unverzichtbares Werkzeug
in jeder Praxis.
The aim of the Rayplicker Cobra is
to offer an objective, reliable and reproducible colour analysis of teeth
based on spectrophotometry, a technology that has been validated and
approved by the scientific community. The tooth shade is analysed ac-
cording to the CIELAB colour space
and the results stratified into different shade mappings: overall shade,
three parts, nine parts and detailed
mapping. This new version of the
Rayplicker is made in France and offers innovative ergonomic features.
The device is equipped with a miniaturised measuring head, and the remote LEDs at the end of the measuring head allow easy access to all of
the patient’s teeth. The autoclavable
calibration tips allow the self-calibration of the device and protect against
cross-contamination. In addition, its
OLED screen guides the user through
shade taking and the Wi-Fi transmission of the live video on the computer
screen. The ease of communication
makes the experience truly educational for the patient.
The spectrophotometer, in combination with the free Rayplicker Vision
software, allows the user to carry out
colorimetric and translucency analysis of a tooth. The software provides
optimised patient data management
as well as numerous functionalities,
such as the evaluation of bleaching
treatments and the editing of shade
reports.
For the best transmission of information, both dental practices and den-
tal laboratories benefit from free access to the Borea Connect platform,
which is accessible from a web
browser. The platform is an essential
tool for the management and realtime monitoring of orders and ensures easy and fast sending of the
data necessary for the proper production of prostheses. This data includes
shades, patient photographs and digital impressions.
The new Rayplicker Cobra provides a complete and innovative solution for communication between the
dental professional and the laboratory. It allows a reduction of the waste
related to shade taking, and it brings
true comfort and time-saving while
improving communication with patients.
Owing to the easy reading of CIELAB values, the Rayplicker Cobra is
compatible with manufacturing recipe applications for dental technicians, making it a revolutionary and
indispensable tool in every practice.
BOREA, France
www.borea-dental.com
Hall 3.1, Booth J081
INNOVATION SCHLÄFT NIE: A-DEC PRÄSENTIERT NÄCHSTE NEUENTWICKLUNG AUF DER IDS
INNOVATION NEVER SLEEPS: A-DEC TO SHARE ITS NEXT NEW DEVELOPMENT AT IDS
Können Sie das machen? Dieser
Satz von Zahnärztinnen und Zahnärzten löst heute noch das gleiche
innovative Denken aus, um Probleme bei Dentalgeräten kreativ zu
lösen, wie vor fast 60 Jahren, als
A-dec aufgrund einer Erfindung und
eines Traums gegründet wurde.
Schon damals wusste A-dec, dass
zahnmedizinisches Personal, das
die Produkte täglich verwendet, die
beste Innovationsquelle ist. Im Laufe
der Jahre hat das Unternehmen ein
großes Netzwerk von Zahnärztin-
nen und Zahnärzten sowie wichtigen Meinungsführern aufgebaut, mit
denen es eng zusammenarbeitet
und Praxistests durchführt. Es ist
ebendiese ergebnisorientierte Innovation, die A-dec hilft, Probleme in
der Praxis zu verstehen und gleichzeitig die Möglichkeit bietet, Lösungen zu finden, die zur Verbesserung
beitragen. Mit zunehmendem Bewusstsein für Berührungspunkte
und Desinfektion in Praxen in den
letzten zehn Jahren entwickelte
A-dec Behandlungsstühle, Hocker,
Leuchten, Behandlungssysteme, Möbel und Produkte zur Wasseraufbereitung. Jetzt rüstet das Unternehmen für die nächste Innovation auf.
Innovation ruht nie
„Making the best better“ [Das
Beste besser machen] liegt in der
DNA von A-dec, und kein Detail ist
zu klein. Da jeder Abschnitt im Herstellungsprozess für die gesamte Produktpalette eine wichtige Rolle
spielt, kontrolliert A-dec den gesamten Prozess von der Konstruktion
und Fertigung bis zur Montage.
A-dec stellt sogar die meisten Teile
selbst her, angefangen bei der Beschaffung des Rohmaterials, über
das Drehen, Bohren und Fräsen findet alles im Werk der Firmenzentrale
in Oregon in den USA statt. Es gibt
keinen besseren Weg, um die Zuverlässigkeit, Langlebigkeit und konstante Leistung sicherzustellen. A-dec
entwickelt jedes einzelne Bauteil seiner Geräte auf die Weise, sodass das
gesamte Praxisteam von besseren
Arbeitsabläufen, Effizienz und Komfort profitiert.
Seien Sie versichert, dass A-dec
nie aufhören wird, innovativ zu sein –
von Behandlungsstühlen und -systemen über Praxismöbel und -leuchten bis hin zu Kompressoren, Absauganlagen und Entkeimungsanlagen. Kommen Sie und sehen Sie, was
als Nächstes kommt.
Can you do this? That phrase from
dentists today prompts the same
spark to creatively solve dental
equipment challenges as it did nearly
60 years ago when A-dec was founded
on an invention and a dream. Even
then, A-dec knew that the best sources
of innovation are the dental teams
who use the products every day.
Through the years, the company has
built a large network of dentist advocates and key opinion leaders with
whom it partners and field-tests. It is
this outcome-driven innovation that
helps A-dec understand pain points
and identify opportunities to create
and improve. With increased awareness of touchpoints and of sanitisation in practices over the past decade,
40th International Dental Show 2023 • 14. März 14 March
A-dec designs dental chair units,
stools, lights, delivery systems, furniture and waterline maintenance products with this in mind. Now, the company is ramping up for the next
innovation.
Innovation never settles
“Making the best better” is in
A-dec’s DNA, and no detail is too
small. Since every part of the manufacturing process matters across the
full line of products, it controls the
entire process, including engineering,
manufacturing and assembly. The
company even makes the majority of
the parts it uses—sourcing the raw
materials, then turning, drilling and
milling them at its main site in Oregon in the US. There is no better way
to ensure reliability, longevity and
consistent performance. A-dec designs every piece of its equipment to
help dental teams enjoy better workflow, efficiency and comfort.
From dental chair units and delivery systems to dental furniture and
lights, to mechanical room equipment
and sterilisation centres, rest assured, A-dec will never stop innovating. Come see what’s next!
A-dec, USA
www.a-dec.com
Hall 11.1
Booth D010/E019
[23] =>
untitled
[24] =>
untitled
industry
24
DENTATUS: QUALITY SOLUTIONS FOR DENTISTRY AND THE WORLD
Founded in 1930, Dentatus has
been developing, manufacturing and
supplying unique dental solutions for
over 95 years. Since its inception, the
company has pioneered numerous
groundbreaking products, including
precision articulators introduced in
1944 and the first prefabricated classic metal post, which has become an
industry standard.
Profin is clinicians’ system of choice.
Profin consists of contra-angle handpieces and Lamineer diamond-coated
tips. The handpieces move in an axial
direction with reciprocating motion
(1.2 mm stroke). Thanks to their thin
design, the tips provide optimal access to areas that are difficult to
reach, and the one-sided diamond
coating promotes safety and control.
ance and delivering predictable, successful treatment results consistently. The IPR tips are calibrated for
the amount of reduction, enabling
precise results without the use of an
additional gauge. The tips are colour-coded by tip thickness and are
double-sided for maximum efficiency.
The Complete IPR Solution is compatible with all aligner systems and
ups. These high-quality prefabricated
metal posts are both dependable and
economical.
Luscent anchors—the original
translucent posts — are made of unidirectional fibreglass rods encapsulated in a strong resin matrix. They
enable aesthetic, long-lasting restorations and feature excellent strength
characteristics.
The Atlas implant has been designed for long-term use to retain and
stabilise dentures. Eliminating the
hardware typically associated with
overdentures, the Atlas system uses
no O-rings, housings or adhesives. Instead, the unique Tuf-Link silicone relining material is mechanically secured within the denture by an
undercut and provides a cushioned
fit for stress-free denture insertion,
retention and removal.
Matrix system
From left: Profin reciprocating system, Complete IPR Solution (Profin PDX contra-angle handpiece with the IPR tips kit), gold Surtex Classic post, Luscent anchors, Dentatus Anew narrow-body implant,
Atlas implant and matrix system.
Dentatus believes that true quality means creating solutions that are
good not only for dentistry but also
for the environment. At the heart of
Dentatus is a commitment to providing sustainable, high-quality products
without compromise.
Profin reciprocating system
For shaping, contouring and polishing natural dentition and cosmetic
restorations with ease and flexibility,
The Lamineer tips are available
in a variety of shapes, sizes and grits,
making Profin perfect for everything
from routine hygiene and periodontal
care to orthodontics, cosmetic dentistry and CAD/CAM restorations.
In 2022, Dentatus introduced the
Complete IPR Solution for quick and
efficient interproximal reduction (IPR)
procedures, saving time, improving
patient comfort, reducing clinician
stress, ensuring treatment compli-
was launched in anticipation of the
growth of the global clear aligner market. This is also reflected in Dentatus’s
special offer at IDS: Profin PDX contraangle handpiece with IPR tips starter
kit at a reduced cost of €237.34 (SRP).
Post systems
Surtex Classic posts are the
global standard for post systems, offering dentists consistently reliable
solutions for post and core build-
Implant systems
The Dentatus Anew narrow-body
implant is the best treatment option
for patients lacking time, money or
sufficient bone structure. It is the
only narrow-body implant with a
screw-retained prosthetic system. It
has received U.S. Food and Drug Administration clearance for long-term
use, has been validated for permanent use and is supported by over 20
years of clinical research.
Based on the inventor’s original
design, Nyström matrix retainers and
Dentatus matrix bands offer dentists
a complete system for everyday reliability. Nyström retainers can be applied lingually or buccally for firm adaptation of the matrix band to the
tooth and promote secure retention
and ease of use. Dentatus matrix bands
are manufactured from the highestquality stainless steel and have perfectly smooth edges. The company’s
special series Class V matrix bands are
especially useful in recreating gingival margins of Class V restorations.
Visit the Dentatus booth to gain
more insights into our products and
learn more about our specials!
Dentatus, Sweden
www.dentatus.com
Hall 10.1
Booth G070/H071
NEUE ZAHNMEDIZINISCHE BILDGEBUNGSTECHNOLOGIE BRINGT PATIENTENVERSORGUNG IN NEUE DIMENSIONEN
NEW DENTAL IMAGING TECHNOLOGY TAKES PATIENT CARE TO A NEW LEVEL
Das japanische Unternehmen
PreXion ist einer der führenden Anbieter dentaler 3D-Bildgebungstechnologie und stolz, sein brandneues
Produkt, den PreXion3D EXPLORER
PRO, auf den europäischen Markt
zu bringen. Dieses High-End-DVTSystem ist ein Novum in der zahnmedizinischen Bildgebung, denn es
kombiniert 3D-DVT-Aufnahmen mit
Volumen von 5 × 5 cm bis 15 × 16 cm,
einen speziellen OPG-Modus und
One-Shot-CEPH-Aufnahmen
ohne FRS-Auslegerarm. Der
PreXion3D EXPLORER PRO
bietet ein breites Spektrum
an klinischen Anwendungen,
von der endodontologischen
Behandlung über die MKGChirurgie bis hin zu Atemwegsanalysen.
Einer der wichtigsten
Vorteile des PreXion3D
EXPLORER PRO ist seine
fortschrittliche Technologie,
die das weltweit erste im Gerätekopf
integrierte kephalometrische Röntgenbild liefert. Diese innovative Technologie ermöglicht es dem Gerätekopf,
sich automatisch um 45 Grad zu drehen und um 30 cm zu öffnen, um
kephalometrische Röntgenbilder als
One-Shot aufzunehmen. Der PreXion3D
EXPLORER PRO ist eine kosteneffektive Lösung für Zahnarztpraxen, denn
durch die innovative Technologie
kann auf einen zusätzlichen FRS-Auslegerarm verzichtet werden. Dieses
kompakte Design spart Platz und er-
möglicht eine einfache Installation
in jeder Zahnarztpraxis.
Der PreXion3D EXPLORER PRO
verfügt auch über einen hochwertigen Flachbildsensor und einen Brennpunkt, der mit 0,3 × 0,3 mm zu den
kleinsten gehört, dadurch wird eine
präzise 3D-Bildgebung ermöglicht.
Die Kombination aus gepulster Strah-
lung und hoher Spannung gewährleistet eine geringe Strahlendosis für
Patientinnen und Patienten, und
macht das Gerät zu einer sicheren
und zuverlässigen Wahl.
Der PreXion3D EXPLORER PRO
ist ein High-End-DVT-System, das fortschrittliche Technologie, Präzision, Geschwindigkeit und Sicherheit in der
zahnmedizinischen Bildgebung bietet. Zahnärztinnen und Zahnärzte
können ihren Patientinnen und
Patienten jetzt eine umfassende und effiziente
Lösung für ihre diagnostischen Bedürfnisse anbieten.
The Japanese company PreXion, one of the
leading providers of dental imaging technology,
has launched PreXion3D
EXPLORER PRO, a high-end
CBCT system that is part of
the PreXion 3D EXPLORER series is
a game-changer in the dental imaging market, combining large-field
CT from 5 × 5 cm to 15 × 16 cm, dedicated panoramic mode, and one-shot
cephalometric imaging without a
ceph arm. The PreXion3D EXPLORER
PRO offers a wide range of clinical
applications, from endodontic treatment to maxillofacial surgery and airway analysis.
One of the most significant advantages of the PreXion3D EXPLORER
PRO is its advanced technology that
delivers the world’s first gantry-integrated cephalometric radiograph with
innovative built-in ceph arm design.
Therefore, the CBCT is able to automatically shift 45 degrees and open
by 30 cm to capture cephalometric radiographs.
The PreXion3D EXPLORER PRO
eliminates the need to purchase an
additional ceph arm, making it a
cost-effective solution for dental practices. Its compact design saves space
and allows for easy installation in
any dental office.
The PreXion3D EXPLORER PRO
also features a high-quality panel and
a focal spot that is among the least
sizeable in the industry at only
0.3 x 0.3 mm, allowing for precise 3D
imaging. The combination of pulsed
irradiation and high voltage ensures
low radiation doses, making it a safe
and reliable option for patients.
40th International Dental Show 2023 • 14. März 14 March
The PreXion3D EXPLORER PRO
is a high-end CBCT system that offers advanced technology, precision,
speed and safety in dental imaging.
Dental professionals can now offer
their patients a comprehensive and
efficient solution for their diagnostic needs.
PreXion Europe,
Germany
www.prexion.eu
Hall 11.1
Booth A058/B059
[25] =>
untitled
HALL 3.1
STAND J081
DISCOVER THE NEW SHADE
SCANNER RAYPLICKER COBRA !
R R
Shade
mapping
Translucency
mapping
Polarized
black & white
image
Bleaching
report
L*a*b* coordinates
Rayplicker Cobra is a class I medical device. It bears the CE mark in accordance with the European Medical
Device Regulation (EU) 2017/745. CE marking: 2022. Made in France by BOREA.
For professional use only. A14_EN_01_23
DISCOVER
COBRA IN VIDEO
[26] =>
untitled
industry
26
BIODENTINE XP: ALLE VORTEILE VON BIODENTINE MIT EINER NEUEN EXPERIENCE
BIODENTINE XP: ALL THE BIODENTINE SCIENCE WITH THE EXPERIENCE YOU EXPECT
Biodentine war der erste biokompatible und bioaktive Dentinersatz.
Seit seiner Markteinführung im
Jahr 2010 hat Biodentine seine klinischen Vorteile unter Beweis gestellt.
Es bietet Bioaktivität und Biokompatibilität, um Dentin in der Krone und
in der Wurzel vollständig zu ersetzen. Das belegen mehr als 1.000 Veröffentlichungen.
Dank seiner hervorragenden
Versiegelungs- und mechanischen
Eigenschaften kann Biodentine als
Bulk-Fill-Material verwendet werden, indem die Kavität von der Pulpa
bis zum oberen Rand gefüllt wird –
mit einer endgültigen Schmelzrestauration innerhalb von sechs Monaten. Das Verfahren ist einfach und
schnell, da nur ein Material verwendet wird.
Auf der IDS 2023 stellt Septodont
eine neue Version von Biodentine
vor – Biodentine XP – ein neues System zur Dentinrestauration mit einem Kartuschensystem, das direkt
im Zahn eingesetzt werden kann,
um Zahnärztinnen und Zahnärzten
die tägliche Arbeit zu erleichtern.
Biodentine XP steht für die wissenschaftliche Expertise von Biodentine,
eingebettet in ein neues und optimiertes System, das sich ideal in
die zahnärztlichen Arbeitsabläufe
integriert – von der Produktvorbe-
haltung der deutschen Gesetze über
die Werbung für Medizinprodukte.
reitung bis zur direkten Platzierung
im Zahn.
Biodentine XP lässt sich dank
seines Hochleistungsmixers einfach
und perfekt anmischen und mit der
Applikationspistole leicht verarbeiten. Die All-in-one-Kartuschen sind
in zwei Größen (XP 200 und XP 500)
erhältlich, je nach Anwendungsfall,
Tiefe der Kavität und benötigter
Menge.
Die einfache Anwendung und
die zahlreichen Einsatzmöglichkeiten von Biodentine XP von der Krone
bis zur Wurzel helfen Zahnärztinnen
und Zahnärzten jeden Tag bei der Behandlung ihrer Patientinnen und Patienten.
Hinweis: Biodentine XP ist ein
Medizinprodukt der Klasse III und
wartet derzeit auf seine CE-Kennzeichnung. Die in diesem Text enthaltenen Informationen richten sich
an das internationale Fachpublikum
aus dem Gesundheitswesen der
IDS 2023 und sind nicht speziell für
in Deutschland praktizierende Mediziner bestimmt und unterliegen daher nicht der Verpflichtung zur Ein-
Biodentine was the first all-in-one
biocompatible and bioactive crown
and root dentine substitute. Since its
launch in 2010, Biodentine has proved
its clinical benefits, offering bioactivity and biocompatibility to fully replace dentine in the crown and in the
root. Its multiple successes are supported by more than 1,000 publications.
Thanks to its unique features,
outstanding sealing and mechanical
properties, Biodentine can be used as
a bulk fill material, filling the cavity
from the pulp to the top—a final enamel
restoration must be performed within
six months. The procedure is easy
and fast, as the same material is used.
At IDS 2023, Septodont is introducing a new version of Biodentine—
Biodentine XP—a new dentine restoration system with an all-in-one
cartridge, offering direct placement
in the tooth to facilitate practitioners’
daily work.
Biodentine XP brings to clinicians
the proven science of Biodentine, embedded in a new and upgraded system that is designed to provide dentists with an optimal daily experience,
from product preparation to direct
placement in the tooth.
Biodentine XP ensures easy and
perfect mixing, thanks to its highspeed mixer, and easy delivery with
the Biodentine applicator gun. The allin-one cartridges are available in two
formats (XP 200 and XP 500), depending on the procedure, the depth
of the cavity and the quantity needed.
The ease of use and multiple indications of Biodentine XP from the
crown to the root will help dentists in
their daily treatment of their patients.
Visit us at IDS 2023 to find out more
about this exciting new product.
Note: Biodentine XP, a Class III
medical device, is awaiting CE marking. The information contained in this
text is intended for an international
audience of healthcare professionals
attending IDS 2023 and is not specifically intended for healthcare professionals practising in Germany and is
therefore not subject to the obligation
of compliance with the German law
relating to the advertising of medical
devices.
Septodont, France
www.septodont.com
Hall 11.1
Booth C010/D019
AD
METASYS IDS NOVELTIES
)$ ! $! $ $Ĺ
$!" "!$ " +$ ( $
$$ &
" !$Ĺ
$ $ !"
" !$!)$$
$&$
"&$"+"$ "Ĺ
!(
! $$ !"&$ &")! Ƒ!ƒ"&$$!"
! +Ĺ
) $ ! + )"$
IDS 2O23 | ƐƓĺƏƒĺ҄ƐѶĺƏƒĺƑƏƑƒ|
ƐƏĺƑĺ" !ĺƏƓƐ
th
40
International Dental Show 2023 • 14. März 14 March
$ƳƓƒƔƐƑƑƏƔƓƑƏŇbm=oŠl;|-vvĺ1olŇl;|-vvĺ1ol
[27] =>
untitled
[28] =>
untitled
industry
28
BEAUTIBOND XTREME VON SHOFU: ÄTZEN, PRIMEN UND BONDEN IN EINEM SCHRITT
BEAUTIBOND XTREME BY SHOFU: ETCH, PRIME AND BOND IN ONE STEP
Mit dem neuen BeautiBond Xtreme
steht dem Zahnarzt ein lichthärtendes, selbstätzendes All-in-one-Universaladhäsiv zum Befestigen direkter
und indirekter Restaurationen zur
Verfügung.
Wie sein Vorgänger BeautiBond
Universal liefert es hervorragende
Haftfestigkeitswerte, geringe Techniksensitivität und die komfortable
Anwendung in einem Arbeitsgang.
Ein Aktivator oder Enhancer für bestimmte Restaurationsmaterialien ist
jetzt nicht mehr nötig.
BeautiBond Xtreme spielt überall dort seine Stärken aus, wo es um
gute Haftverbundwerte geht. Dank
eines neuartigen Silanhaftvermittlers ARS (acid-resistant silane coupling agent) entstand eine sehr stabile chemische Zusammensetzung.
Ohne zusätzlichen Primer stellt das
Adhäsiv einen zuverlässigen Verbund der unterschiedlichsten Restaurationsmaterialien am Schmelz
und am Dentin sicher. Ganz gleich,
ob die Zahnoberfläche feucht oder
trocken ist und welche Ätztechnik
zum Einsatz kommt.
Neben der adhäsiven Befestigung direkter und indirekter Restaurationen eignet sich BeautiBond
Xtreme zum Festsetzen von Wur-
zelstiften und Stumpfaufbauten, zur
Reparatur frakturierter Restaurationen sowie zur Versiegelung von
Präparationen.
Die ergonomisch geformte Dosierflasche ermöglicht das Öffnen,
Dosieren und Verschließen mit nur
einer Hand. Die speziell geformte Dosierspitze gibt sehr kleine Tropfen
ab (ca. 260 Tropfen) – Garant für
sparsame Dosierung bei minimalem
Materialverlust. Ätzen, Primen und
Bonden erfolgen schnell und sicher
in nur einem Arbeitsgang. Lästige
Arbeitsschritte wie Schütteln oder
Mischen und wiederholtes Auftragen entfallen, so gelingt das Bonden
schnell und zuverlässig.
BeautiBond Xtreme fließt sehr
gut an und lässt sich präzise auftragen. Die nur ca. 5 μm dünne
Filmschicht macht das füller- und
HEMA-freie BeautiBond Xtreme besonders bei minimalinvasiver Vorgehensweise und hochästhetischen Füllungen zum Adhäsivsystem der Wahl.
BeautiBond Xtreme lässt sich
ohne Qualitätseinbußen bei einer
Temperatur zwischen 1 und 25°C
lagern. Es muss vor der Anwendung
nicht auf Zimmertemperatur erwärmt werden, sondern ist sofort
einsatzbereit.
SHOFU offers dental professionals
BeautiBond Xtreme, a new light-curing, self-etch, all-in-one, universal adhesive for bonding direct and indirect restorations.
Just like its predecessor BeautiBond Universal, this adhesive is characterised by excellent bond strengths,
low technique sensitivity and convenient application in one step. But users
no longer require an activator or enhancer for certain restorative materials.
BeautiBond Xtreme will play to
its strengths wherever strong bonds
are needed. The innovative acidresistant silane coupling agent (ARS)
makes the chemical composition
highly stable. Without an additional
primer, this adhesive reliably bonds a
wide variety of restoratives to enamel
and dentine. It does not matter whether
tooth surfaces are wet or dry or what
etching technique is used.
Besides bonding direct and indirect restorations, BeautiBond Xtreme
can also be used in cementing root
posts, creating core build-ups, repairing fractured restorations, or sealing
tooth preparations.
Thanks to the ergonomic design
of the dispensing bottle, opening, dispensing, and closing can be done
with just one hand. The nozzle has
been specially designed to deliver
very small drops (about 260 per bottle), ensuring economical dispensing
with only minimal loss of material.
BeautiBond Xtreme allows users
to etch, prime and bond quickly and
reliably in one step. Inconvenient
work steps, such as shaking or mixing and repeated application, have
been eliminated, so bonding is fast
and dependable.
BeautiBond Xtreme adapts very
well to surfaces and can be applied
precisely. The adhesive film is only
about 5 μm thick, which makes this
filler- and HEMA-free adhesive the
system of choice, particularly for
minimally invasive dentistry and
highly aesthetic restorations.
BeautiBond Xtreme can be stored
at temperatures between 1 and 25°C
without degradation. It does not have to
warm up to room temperature before
use but can be used immediately.
SHOFU Dental,
Germany
www.shofu.de
Hall 11.3
Booth C010/E019
HEYSMILE WIRFT EIN WEGWEISENDES LICHT AUF UNSICHTBARE KIEFERORTHOPÄDIE
HEYSMILE BRINGS A TRAILBLAZING VISION TO INVISIBLE ORTHODONTICS
Die Planmeca-Gruppe macht sich jetzt
in der unsichtbaren Kieferorthopädie einen
Namen. HeySmile ist ein völlig neues, rein
digitales und durchsichtiges Alignersystem,
das sich flexibel an die unterschiedlichsten
Behandlungen, Arbeitsabläufe und Geräte
anpassen lässt. Das System ist eine von
Zahnärztinnen und Zahnärzten gesteuerte
und gänzlich offene Lösung, die sich problemlos in jede Zahnpraxis oder -klinik integrieren lässt.
Mit HeySmile liegt die Alignertherapie in
den Händen der Zahnärzteschaft. Die digitale
Plattform HeySmile Studio ermöglicht mit nur
ein paar Klicks die Erstellung einer vollständigen Diagnose und Behandlungsanweisung
und ist mit offenen 3D-Dateien von nahezu allen Intraoralscannern und Bildgebungsgeräten
kompatibel. Durch die unmittelbare Kommunikation mit dem Labor von HeySmile wird garantiert, dass der Behandlungsplan stets den
Behandlungszielen entspricht.
Alles findet in den hochmodernen Räumlichkeiten von HeySmile statt, von der Behandlungsplanung über die Produktion bis hin
zur Qualitätssicherung. Dank des erfahrenen
Teams von Zahntechnikerinnen und Zahntechnikern und der jahrzehntelangen Expertise
von Planmeca im Bereich Zahnmedizin weisen
die HeySmile-Behandlungspläne eine der
höchsten Akzeptanzraten für das erste Set-up
auf dem Markt auf.
Die Aligner-Schienen werden aus HeySmiles
einzigartigem dreischichtigen Timanti-Material
hergestellt, wodurch sie ihre Form behalten und
gleichzeitig die Zähne der Patientinnen und
Patienten schonend in die gewünschte
Position bringen. So liefern die Behandlungen
von HeySmile unglaublich vorhersehbare Ergebnisse, bei minimalem Unbehagen. Dank des reibungslosen In-House-Verfahrens können die
Aligner-Schienen für gewöhnlich binnen einer Woche entworfen, hergestellt und geliefert werden.
„Wir von Planmeca suchen stets nach den
kleinen alltäglichen Herausforderungen, die
wir in der Zahnpraxis bzw. -klinik lösen können. HeySmile löst drei solcher Herausforderungen: die effektive, transparente Alignertherapie wird von Ärzten gesteuert, liefert
vorhersehbare Ergebnisse und ist für alle
zugänglich. Wir können mit Stolz behaupten,
dass HeySmile sich von allen anderen Alignersystemen auf dem Markt unterscheidet“,
sagte Jukka Kanerva, Senior Vice President bei
Planmeca.
HeySmile hat seinen Sitz in Málaga in
Spanien, und seine Dienstleistungen werden
laufend in ganz Europa erweitert. Entdecken
Sie HeySmile und die digitale Komplettlösung
von Planmeca am Stand des Unternehmens.
Planmeca Group is ready to make its mark in
invisible orthodontics. HeySmile is its brandnew all-digital clear aligner system, which can
flexibly adapt to the widest range of treatments,
workflows and tools. It is a dentist-driven and
completely open solution that integrates seamlessly into any dental clinic.
HeySmile puts the dentist in charge of the
aligner treatment. The HeySmile Studio digital
platform allows the dentist to make a complete
40th International Dental Show 2023 • 14. März 14 March
diagnosis and enter the treatment prescription
with just a few clicks, and it accepts 3D image
files from nearly any intra-oral scanner. Direct
communication with a HeySmile dental technician ensures that the treatment plan is always
in line with the dentist’s treatment goals.
Everything is completed at HeySmile’s stateof-the-art facilities, from treatment planning to
manufacturing and quality assurance. Powered
by an experienced team of dental technicians
and Planmeca’s decades-long expertise in dentistry, HeySmile treatment plans have one of the
highest acceptance rates for first set-ups in the
market.
The aligners are made of HeySmile’s unique
three-layer Timanti material, which allows the
aligners to maintain their shape while gently
guiding the patient’s teeth into the desired position. As a result, HeySmile treatments offer incredibly predictable results while minimising
patient discomfort. Thanks to the seamless inhouse process, the aligners can usually be designed, manufactured and shipped within one
week.
“At Planmeca, we are always looking for
that everyday challenge we can solve in the dental clinic. HeySmile solves three—an effective
clear aligner treatment solution that is truly
doctor-driven, predictable and open to everyone.
We are proud to be able to say that it is unlike
any other aligner system out there,” said Jukka
Kanerva, senior vice president at Planmeca.
HeySmile is based in Malaga in Spain, and
is currently expanding its services all over Europe. Discover HeySmile and Planmeca’s complete digital solution at the company’s booth.
Planmeca, Finland
www.planmeca.com
Hall 1.2, Booth A020/C029
[29] =>
untitled
NEW
One click.
Two tables.
Three times as quick.
®
PrograScan PS7
Simultaneous high speed for perfection
– Scan upper and lower jaw models
simultaneously in 10 seconds
– Auto detection of all accessories
– Get your 3D models in 2 minutes
LET‘S MEET AT IDS 2023!
HALL 11.3 | BOOTH A20/A10
ivoclar.com
Making People Smile
[30] =>
untitled
industry
30
DIE GESTALTUNG DER ZUKUNFT ÄSTHETISCHER UND FUNKTIONELLER ZAHNMEDIZIN
SHAPING THE FUTURE OF AESTHETIC AND FUNCTIONAL DENTISTRY
Die dentale Denkfabrik edelweiss dentistry
ist dafür bekannt, das einzige biomechanische
Direkt-Veneer-System ent wickelt zu haben,
welches die Nachteile organischer Füllstoffe, die
üblicherweise für Kompositverblendungen verwendet werden, überwunden hat. Durch ein einzigartiges Lasersinter-Konzept hat diese Technologie die natürlichen Defizite herkömmlicher
Kompositmaterialien drastisch reduziert und
dadurch die Ästhetik und Funktion verbessert.
Die Produktpalette umfasst ultradünne
Schmelzschalen für den Frontzahn- und Okklusalbereich, das edelweiss POST & CORE Wurzelkanalsystem und das edelweiss PEDIATRIC CROWN
System. Die neueste Ergänzung der Produktpalette sind die edelweiss CAD/CAM BLOCKs (T- und
AD
C-BLOCK) und die i-BLOCKs (Implantatblock), bestehend aus dem
weltweit ersten Hybridglas-Material
mit Tri-Network-Struktur, das reines
Glas, Aluminiumoxid und ResinTechnologie in einem Block vereint,
um so außerordentliche Ästhetik,
Festigkeit und Resilienz zu garantieren.
Noch nie war es möglich, die
natürliche Form und die jugendFrom left: VENEER and OCCLUSIONVD shells, CAD/CAM BLOCKs, POST & CORE system and PEDIATRIC CROWNs.
liche Leuchtkraft eines Zahns in
nur einer Sitzung so einfach und
perfekt zu gestalten. Das vielseitige EinsatzSYSTEM zu einer sicheren Investition in die
Die Philosophie von edelweiss dentistry ist
gebiet sowie das zeit- und kostensparende
Zukunft, und dies im besten Interesse des
simpel: Zahnbehandlungen für Patienten und
Patienten.
Verfahren machen das edelweiss DIRECT
Zahnärzte gleichermaßen einfach und erschwinglich zu gestalten. Ein weiterer Schwerpunkt liegt
auf den ethischen Aspekten moderner Behandlungen, die durch die Einhaltung der Prinzipien
von Biokompatibilität und Bioästhetik erreicht
werden. Dies ermöglicht minimalinvasive Behandlungen, da die Restauration unter Erhaltung
der gesunden Zahnsubstanz durchgeführt wird.
Funktion und Ästhetik werden mit einem der
Zahnsubstanz sehr ähnlichen Hybridglas-Material rekonstruiert – nach dem Konzept der adhäsiven Additivtechnik.
Damit ist das edelweiss DIRECT SYSTEM auf
dem neuesten Stand der modernen und minimalinvasiven Ästhetischen Zahnmedizin. Überzeugen
WhiteTiger diamonds
Sie sich selbst und testen Sie unsere Produkte live
New with gold-plated shaft. This makes it very easy to distinguish the highquality WhiteTiger diamond instruments from conventional instruments.
an einer Hands-on-Station am edelweiss Stand.
White TIGER Diamonds
LLD - Bonding
35%
65%
Blank
Multilayerr - Diamond
A special bond securely binds the multilayer diamond particles. The
additional, wear-resistant LLD coating ensures an improved service life
as well as increased abrasion performance compared to conventional
diamond instruments. WhiteTiger diamonds thus enable gentle treatment.
The multilayer diamond structure ensures fast and effective material
abrasion. The LLD coating reduces clogging of the chip spaces and thus
lowers heat generation.
Specifically for crown abutment and cavity preparation. The increased
abrasion rate and better cooling compared to conventional instruments
deliver an efficient and at the same time gentle, optimal preparation result.
Solid Nickel Matrix
}
3
2
1
3x Nickellayer
WhiteTIGER
Crown Cutters
Crown cutter C4AK
For cutting low-fusing veneering ceramics and metal frameworks in a single
working step, easily and quickly. The novel MultiCut toothing enables fast
chip removal and ensures good instrument stability with a high breaking
strength. The new toothing system ensures smooth and low-vibration
operation. The crown cutters are to be placed at an angle of 45°.
Caution: the crown cutters must not be used for separating all-ceramic
restorations made of extremely hard ceramics, e.g. zirconium oxide. Use
the K-diamonds for separating all-ceramic materials, as they have been
developed specifically for this application. Speed ideally 160,000 rpm,
contact pressure: 0.5 N
Crown cutter C34LT
New generation of crown cutters with TiN high-performance coating for
optimal chip removal and smooth, low-vibration operation. The toothing
with crosscut and overhead cutting edge ensures maximum cutting
performance as well as a long service life, even when cutting non-precious
metal crowns.
The crown cutter C34LT.315.012 is to be placed at an angle of 45°. The
crown cutter C34LT.315.016 can be used both at a 45° angle as well as flat.
Notes on use: 1. cut open the ceramic veneer with a diamond instrument
(K-diamond) 2. cut the metal framework with the crown cutter – optimal
speed 160,000 rpm, contact pressure 0.5 N
40
th
Hall 11.3, Booth A060 - B069
EDENTA AG, Switzerland
International Dental
Show
2023 • 14. März 14 March
EDENTA
Etablissement,
Liechtenstein
www.edenta.com
The edelweiss dentistry dental think tank is
known for pioneering the only biomechanical direct veneering system that overcomes the disadvantages of the organic fillers commonly used in
composite veneers. Employing a unique laser sintering concept, this technology has dramatically
reduced the natural shortfalls of conventional
composites, thereby enhancing aesthetics and
function.
The product range includes ultrathin anterior
and occlusal enamel shells, the edelweiss POST &
CORE system for post-endodontic needs and edelweiss PEDIATRIC CROWNs. The latest additions
to the product range are edelweiss CAD/CAM
BLOCK (T-BLOCK, C-BLOCK and i-BLOCK—for implant restorations), consisting of the first hybrid
glass material in the world with a tri-network
structure, combining pure glass, aluminium oxide
and resin technology in one block. This en-sures
extraordinary aesthetics, strength and resilience.
Never before has it been possible to create the
natural shape and youthful luminance of a tooth
so easily and perfectly in only one appointment.
Its versatile area of application, in combination
with the time- and cost-saving procedure involved,
makes the edelweiss DIRECT SYSTEM a sound investment in the future with the best interests of
the patient at heart.
The philosophy of edelweiss dentistry is simple: making dental treatments easy and affordable for patients and dentists alike while following
ethical aspects of modern treatment achieved by
respecting the principles of biocompatibility and
bio-aesthetics. This makes minimally invasive
treatment possible. Restorations are carried out
while considering and preserving the healthy
tooth structure. Function and aesthetics are reconstructed—with a highly filled hybrid glass material
very similar to the tooth substance—using an adhesive additive technique.
This makes the edelweiss systems state-of-theart for modern and minimally invasive aesthetic
dentistry. Convince yourself and try our products
at a live hands-on station at the edelweiss booth.
edelweiss dentistry products,
Austria
www.edelweissdentistry.com
Hall 11.3, Booth D040/E041
[31] =>
untitled
AD
industry
31
3D SYSTEMS LÖSUNGEN FÜR DIE DIGITALE ZAHNMEDIZIN
3D SYSTEMS’ DIGITAL DENTISTRY SOLUTIONS
Prothesenbasen, Kronen und Brücken, Schienen und Spangen.
3D Systems bietet Ihnen alles,
was Sie brauchen, wenn Ihr Unternehmen wächst: 3D-Drucker der
Einstiegsklasse für den Dentalbereich, 3D-Drucker für mittlere und
große Stückzahlen, den schnell
skalierbaren NextDent 5100 sowie
eine breite Palette an NextDentWerkstoffen, leistungsfähige 3DSprint-Software und die Integration wichtiger 3D-Scanner und
Softwarelösungen.
Verlassen Sie sich auf unsere
Expertenteams, Materialwissenschaftler und Anwendungsingenieure sowie erfahrene Vertriebshändler für Schulungen und Support,
um optimierte digitale Arbeitsabläufe zu erreichen. Unsere digitalen
Dentallösungen, globale Verfügbarkeit durch zuverlässige Vertriebshändler und Rund-um-die-Uhr-Support bringen Sie auf ein neues
Leistungsniveau.
3D Systems delivers the industry’s broadest range of materials
and 3D-printing solutions validated
for the dental industry, including orthodontics, prosthodontics and implantology. With 3D Systems’ portfolio of 3D printers, software,
NextDent materials and Vertex
Dental products, dental laboratories
and clinics have access to a large
range of dental applications.
Rely on our teams of experts, including materials scientists and
application engineers, and experienced resellers for training and
support to deliver streamlined digital workflows. Our digital dentistry
solutions, global availability through
trusted resellers and 24/7 assistance will bring you new levels of
performance.
NEU – NextDent LCD1
New—NextDent LCD1
Dieser kleine Dentaldrucker
verwendet LCD-Technologie, um
hochwertige Teile mit NextDentWerkstoffen herzustellen. Der NextDent LCD1 ist einfach zu bedienen,
und bietet einen zuverlässigen Gesamtworkflow und eine superglatte
Oberfläche.
This dental printer has a small
footprint and uses a LED array and
LCD mask to produce high-quality
parts with NextDent materials. The
NextDent LCD1 is easy to use and
provides a reliable, complete workflow and a super-smooth surface finish.
NEU – NextDent Wash
New—NextDent Wash
Der NextDent Wash besteht aus
einem Zwei-Behälter-Waschsystem
mit Ethanol, Isopropylalkohol oder
Waschlösungsmittel und verwendet
einen Magnetrührer, der eine einfache Wartung und Reinigung gewährleistet.
Consisting of a two-container
washing system that uses ethanol,
isopropyl alcohol or washing solvent,
the NextDent Wash makes use of a
magnetic stirrer, which ensures
simple maintenance and cleaning.
The system makes it easy to maintain the precise timings recommended for NextDent resins.
NEU – NextDent Cure
Die NextDent Cure ist eine
kleine Härtungsstation, die einfach
zu bedienen ist. Sie ist für die Verwendung mit NextDent-Werkstoffen validiert und gewährleistet eine
perfekt abgestimmte Aushärtung
für diese Produkte.
The NextDent Cure is a small LED
polymerisation station that is easy to
use. Validated for use with NextDent
resins, it ensures perfectly timed polymerisation for these products.
NextDent-Werkstoffe
NextDent by 3D Systems
Mit dem einzigartigen NextDent-Portfolio von 3D Systems mit
über 30 Werkstoffen für den zahnmedizinischen 3D-Druck haben
Dentallabore und -kliniken Zugriff
auf digitale Workflows mit additiver Fertigung für die Produktion in
vielen verschiedenen zahnärztlichen Anwendungen. Die NextDent3D-Druckwerkstoffe für Medizinprodukte sind biokompatibel und
CE-zertifiziert gemäß der Medizinprodukte-Richtlinie 93/42/EEC, bei
der US-amerikanischen Food and
Drug Administration gelistet und in
verschiedenen anderen Ländern
registriert. Die einzigartigen NextDent-Werkstoffe in einer Vielzahl
von ästhetischen Farben sind geeignet für die Herstellung von Modellen (Kieferorthopädie und Prothetik), Bohrschablonen, Löffeln,
Our portfolio of 30 unique 3Dprinting materials addresses multiple dental applications. The resins
are available in a variety of aesthetic
colours to closely match patients’
teeth and gingivae. NextDent 3Dprinting materials for medical devices are biocompatible and certified in accordance with EU medical
device regulation, cleared with the
U.S. Food and Drug Administration
and registered in various other
countries. Our materials can be used
to produce models (orthodontic and
prosthodontic), surgical guides, trays,
denture bases, crowns, bridges, splints
and retainers.
New—NextDent Cure
3D Systems, Netherlands
www.3dsystems.com/dental
Hall 3.1, Booth K010/L011
40th International Dental Show 2023
SHOW
PREVIEW
[32] =>
untitled
/CEJVFCU$GUVG
PQEJGKPHCEJGT
Köln, 14. – 18. März 2023
$GUWEJGP5KGWPU
*CNNG5VCPF%
*CNNG5VCPF0
WPF0
81%1)OD*#PVQP(NGVVPGT5VTC»G%WZJCXGP&GWVUEJNCPF(TGGECNNYYYXQEQFGPVCN
[33] =>
untitled
OUR WORLD.
BESUCHEN SIE UNS
AUF UNSEREM STAND
AUF DER IDS
HALLE 05.2.
STAND D-051
SWISS PREMIUM ORAL CARE
[34] =>
untitled
industry
34
TIPS FOR CHOOSING THE BEST ENDODONTIC SUPPLIER
Market research shows that the endodontic files market is expected to
grow at a compound annual growth
rate of over 5% during the period
2019–2023. Indeed, the market of endodontic files is increasing, and this
growth can be attributed to new advancements in technology and increased safety, flexibility and efficiency. However, the question is: how
can one find the best endodontic supplier?
The factors that should be considered are product quality, price and
supplier capacities. First of all, when
it comes to product quality, the most
important factor to consider is the
quality of the rotary files. Not all rotary files on the market have the
outstanding quality that is necessary
for an improved patient experience.
Secondly, price is always an important factor. Here, the goal is to
choose a supplier that provides the best
quality at a reasonable price. That
way, your purchase will pay for itself.
Thirdly, it is important to take into
account a supplier’s production as
well as research and development
capacities. Ideally, a supplier should
have an extensive production capacity and be able to produce thousands
of rotary files a day. Why? Low production capacity can mean that customers must wait a long time before
they receive ordered files. At the
same time, research and development
capacity speaks volumes about the
supplier’s ability to innovate and to
introduce new and improved products.
Why is Dental Perfect a
great choice?
Dental Perfect was founded in
2008 and has gained extensive experience in the dental industry. Since
its founding, the company has relied
on innovative approaches and the latest technology to enhance the quality
of its products and to raise produc-
tivity to a whole new level. This has
been a success—today, Dental Perfect
produces over 45,000 taper files per
day.
High product quality and adherence to the latest market requirements and regulations has gained
the company a good reputation. What
is more, Dental Perfect’s high-quality
rotary files are available at reasonable prices. Visit the company at IDS
to find out more!
which will help lower electricity costs
and reduce the CO2 footprint of the
practice.
The way in which the suction units
are produced is also beneficial for the
environment. The product is manufactured regionally at the company’s headquarters in Bietigheim-Bissingen in
Germany using recyclable materials.
For predictive maintenance, practices can take advantage of the cloudbased software VistaSoft Monitor,
which allows team members or technical staff (for example from a dental
equipment wholesaler) to check the status and condition of their equipment
at a glance at all times from any computer in the practice, a tablet at home
or via their smartphone. Potential problems with a suction system are detected
before the system is damaged or fails.
As the Tyscor suction units are
designed with scalability in mind, it is
really easy to adjust the system to
changing requirements in your dental
practice. For example, you can expand the practice and add new treat-
ment units―without the need to replace
the existing equipment. Similarly, it is
also possible to analyse problems remotely and fix them via remote maintenance to save a visit to the practice,
which beneficial for environment too.
With Tyscor suction units, the
way your dental practice is run offers
strong support for the environment.
With this product, Dürr Dental has
taken an important step towards a
more sustainable future and therefore supports its customers in saving
energy, with remote maintenance and
scalability of the products in order to
make their practice more sustainable.
Dental Perfect, China
www.dental-perfect.com/doctor
Hall 11.1, Booth D021
TYSCOR – SAUGSYSTEME FÜR EINE NACHHALTIGE PRAXIS
TYSCOR—SUCTION SYSTEMS FOR A SUSTAINABLE DENTAL PRACTICE
Mit Tyscor hat Dürr Dental die
Welt der zahnärztlichen Absaugung
nachhaltig verändert. In welchem
Ausmaß dies den Betrieb grüner
macht, wird nach und nach immer
deutlicher. Dank der konsequenten
Software-Anbindung der Saugsysteme profitieren Umwelt und Praxis
von jedem Fortschritt in der digitalen Welt.
Rein technisch gesehen, hat Dürr
Dental einen Top-Industriestandard
für den zahnmedizinischen Bereich
nutzbar gemacht – die Radialtechnik.
Sie ersetzt bei der neuen SauganlagenGeneration die klassische Seitenkanalverdichtung. Für die Praxis bedeutet dies bis zu 75 Prozent Energieeinsparungspotenzial (gemessen an
der Tyscor VS 4 und einem vergleichbaren Seitenkanalverdichter durch
das Fraunhofer Institut). Das macht
sich in finanziell bemerkbar und senkt
gleichzeitig den CO2-Fußabdruck der
Praxis.
Als vorteilhaft für die Umwelt
erweist sich auch die Produktion der
Saugmaschinen. Das Produkt wird
regional am Standort BietigheimBissingen unter Einsatz von recycelbaren Materialien gefertigt.
Bei einer vorausschauenden Wartung profitiert die Praxis von der
cloudbasierten Software VistaSoft
Monitor. Denn damit hat nicht nur
das Team selbst den Zustand seines
Equipments stets vom Praxis-PC, vom
Tablet zu Hause oder von unterwegs
vom Smartphone aus im Blick, sondern auch der zuständige technische
Service (zum Beispiel vom Dentaldepot). Etwaige Probleme eines Saugsystems werden erkannt, bevor es
zu einem Schadensfall kommt.
Durch die Skalierbarkeit der
Tyscor-Saugmaschinen passen sie
sich den Bedürfnissen der Praxis an.
So können Behandlungsplätze in der
Praxis erweitert werden – und das
ohne Austausch des Bestandsgerätes. Auch können Probleme aus der
Ferne analysiert und durch die Fernwartung behoben werden. In diesem
Falle ist eine Anfahrt gespart – wieder ein Plus für die Umwelt.
Die Tyscor-Saugsysteme machen
die Praxis zu einem starken Pfeiler
für einen umweltfreundlichen Betrieb.
Mit diesem Produkt geht Dürr Dental
nicht nur einen wichtigen Schritt in
eine nachhaltige Zukunft, sondern
unterstützt auch seine Kundinnen
und Kunden durch die Energieeinsparung, Fernwartung und die
Skalierbarkeit der Produkte bei einer
nachhaltigen Praxisversorgung.
With its Tyscor suction system, Dürr
Dental has transformed the world of
dental suction completely. The extent
to which they are making dental practices greener is becoming increasingly
clear. Owing to the suction system’s
seamless integration with a practice’s
software systems, both the environment and practice benefit from every
advance in the digital world.
From a purely technical point of
view, the technology that Dürr Dental
has harnessed for the world of dental
applications is simply one of the best
industry standards currently available―radial technology. With the latest
generation of suction systems, it has
now replaced conventional side channel compression. For dental practices,
this means potential energy savings
of up to 75% (measured on the Tyscor
VS 4 and a comparable side channel
blower by the Fraunhofer Institute),
40th International Dental Show 2023 • 14. März 14 March
Dürr Dental, Germany
www.duerrdental.com
Hall 10.1
Booth E008/F029
[35] =>
untitled
/&-7*.)Ƴ
/&-7*)*38&1'&9*70425*8*3>
:47'*7*.8*8&9+).*>9093+8
&KGPCVKQPCNGWPFKPVGTPCVKQPCNG&GPVCNHCOKNKGCNNGHTGWGPUKEJCWHFKG+&5WPFFGPVCNDCWGTICP\DGUQPFGTU
/GJTFGPPLGIGYKPPVRGTUÒPNKEJG2TÀUGP\CNNGTJÒEJUVGP5VGNNGPYGTV&CUIKNVCWEJHØTFKGDGFGWVGPFUVG&GPVCNOGUUGFGT9GNVOKVFGO
(QMWUCWH+PPQXCVKQPGPWPF6TGPFU'KP6TGHHRWPMVXQPKPVGTPCVKQPCNGP(CEJNGWVGPWPF$TCPEJGPMGPPGTPOKVIGIGPUGKVKIGOHCEJNKEJGOWPF
MQNNGIKCNGO#WUVCWUEJ
5QOKVMQOOVFKGUG.GKVOGUUGHØTFKGFGPVCNDCWGTITWRRGIGPCWKOTKEJVKIGP/QOGPV#NUXQNNWOHCUUGPFGTFGPVCNGT(CEJJÀPFNGT*GTUVGNNGTXQP
RNWNKPGWPF.QIKUVKMFKGPUVNGKUVGTDGITØ»GPYKTWPUGTGPCVKQPCNGPWPFKPVGTPCVKQPCNGP-WPFGPUQYKG)GUEJÀHVURCTVPGTRGTUÒPNKEJCPWPUGTGO
/GUUGUVCPF'KP*CNNG&KGOWNVKMWNVWTGNNGFGPVCNG2NCVVHQTOUQNNKPHQTOKGTGPDGUVGJGPFG-QPVCMVGXGTVKGHGPWPFPGWG-QPVCMVGUEJCHHGP
9KTTGKUGPFCJGTOKVFGODGTØJOVGPFGPVCNDCWGT6GCOURKTKVPCEJ-ÒNPWOWPUGTG)GUEJÀHVUHGNFGT\WRƃGIGPYGKVGT\WGPVYKEMGNPWPFWO
MØPHVKIG#NNKCP\GP\WGTYGKVGTP
&CJGTHTGWGPYKTWPUICP\DGUQPFGTUCWH+JTGP$GUWEJ
=*&74+.)=*&74+)*38&1'&9*7*<5*78.*
57*5&7*)+478-*+9897*
$QVJVJGPCVKQPCNCPFKPVGTPCVKQPCNFGPVCNHCOKN[CTGNQQMKPIHQTYCTFVQ+&5CPFFGPVCNDCWGTKPRCTVKEWNCT
/QTGVJCPGXGTRGTUQPCNRTGUGPEGKUQHWVOQUVKORQTVCPEG6JKUCNUQCRRNKGUVQVJGYQTNFnUOQUVKORQTVCPVFGPVCNVTCFGHCKTYKVJVJGHQEWU
QPKPPQXCVKQPUCPFVTGPFU#ICVJGTKPIQHKPVGTPCVKQPCNFGPVCNGZRGTVUCPFKPFWUVT[KPUKFGTUYKVJOWVWCNRTQHGUUKQPCNCPFEQNNGIKCNGZEJCPIG
6JWUVJKUNGCFKPIVTCFGHCKTEQOGUCVGZCEVN[VJGTKIJVOQOGPVHQTVJGFGPVCNDCWGTITQWR#UCHWNN[EQORTGJGPUKXGFGPVCNURGEKCNKUVFGCNGT
OCPWHCEVWTGTQHRNWNKPGCPFNQIKUVKEUUGTXKEGRTQXKFGTYGYGNEQOGQWTPCVKQPCNCPFKPVGTPCVKQPCNEWUVQOGTUCUYGNNCUDWUKPGUURCTVPGTU
VQQWTGZJKDKVKQPUVCPF'KP*CNN6JGOWNVKEWNVWTCNFGPVCNRNCVHQTOKUFGUKIPGFVQKPHQTOFGGRGPGZKUVKPIEQPVCEVUCPFETGCVGPGY
EQPVCEVU9GCTGVJGTGHQTGVTCXGNNKPIVQ%QNQIPGYKVJVJGYGNNMPQYPFGPVCNDCWGTVGCOURKTKVKPQTFGTVQOCKPVCKPCPFHWTVJGTFGXGNQRQWT
DWUKPGUUƂGNFUCPFVQGZRCPFHWVWTGCNNKCPEGU
9GCTGNQQMKPIHQTYCTFVQUGGKPI[QWVJGTG
)*38&1'&9*7,2'-
-&11*8&3) *
)*38&1'&9*7
)*38&1)*548'*7&893,51&393,*7:.(*
[36] =>
untitled
industry
36
LAON MEDI PRÄSENTIERT KI-BASIERTE CLEAR ALIGNER-SOFTWARE
LAON MEDI PRESENTS ITS AI-BASED CLEAR ALIGNER SOFTWARE
Links/Left: Align Studio. Rechts/right: Appliance Creator.
Mit dem Appliance Creator bringt
LAON MEDI eine hochautomatisierte
Designsoftware für Aligner auf den
Markt, die die virtuelle Einrichtung
und den Export der Modelle und
3D-druckbaren Dateien für transparente Zahnschienen ermöglicht.
Das Unternehmen nutzt künstliche Intelligenz (KI), die von LAON
PEOPLE entwickelt wurde, einem
südkoreanischen Unternehmen, das
seit über zehn Jahren KI-Bildverarbeitungslösungen für verschiedene
Branchen anbietet.
LAON MEDI hat den Appliance
Creator in Zusammenarbeit mit dem
Yonsei University College of Dentistry in Südkorea entwickelt. Gemeinsam haben sie auch die KI-basierte
kieferorthopädische Behandlungsplanungssoftware Align Studio und
die automatische kephalometrische
Landmarking- und Simulationssoftware LaonCeph entwickelt.
Align Studio verfügt über Funktionen wie vollautomatische Zahnsegmentierung, Zahnachsenerkennung, Zahnmarkierung und Zahnnummerierung. Die automatische
Behandlungsanalyse ist die innovativste KI-Technologie in der digitalen
Zahnheilkunde.
Appliance Creator dient zum
Entwerfen von 3D-gedruckten durchsichtigen Alignern. Damit können
Benutzerinnen und Benutzer Aligner erstellen, ohne ein kieferorthopädisches Modell drucken zu müssen. Darüber hinaus kann es automatisch Grenzlinien generieren. Neben den oben genannten Produkten
stellt LAON MEDI an seinem Stand
auf der IDS seinen Intraoralscanner
True Scan vor.
LAON MEDI is launching highly
automated clear aligner design software that enables virtual set-up and
export of the models and 3D-printable clear aligner files—Appliance
Creator. The company uses artificial
intelligence (AI) technology developed by LAON PEOPLE, a South
Korean company that has been supplying AI machine vision solutions to
various industries for over ten years.
LAON MEDI has developed Appliance Creator in cooperation with
the Yonsei University College of Dentistry in South Korea. Together, they
have also designed AI-based orthodontic treatment planning software,
Align Studio, and automatic cephalometric landmarking and simulation
software, LaonCeph.
Align Studio has features such as
fully automatic tooth segmentation, tooth
axis virtual generation, tooth landmarking and tooth numbering. Automatic
treatment analysis is the most innovative AI technology in digital dentistry.
Appliance Creator is for designing direct 3D-printed clear aligners.
With it, users can create a clear aligner
without having to print the orthodontic model. Additionally, it can automatically generate margins.
Besides the aforementioned products, LAON MEDI is introducing its
intra-oral scanner, True Scan, at its
booth at IDS.
HYGIENE AUF HÖCHSTEM NIVEAU
HYGIENE NEXT LEVEL
Wenn technisch funktionale
Belmont-Qualität auf eine hochwertige Eleganz trifft, heißt das Resultat EURUS. Die innovative Behandlungseinheit des japanischen Traditionsunternehmens vereint effiziente Behandlungsabläufe, zeitgemäßen Komfort und elegantes Design, gepaart mit einer überragenden
Zuverlässigkeit. Die neueste Generation des Erfolgsmodells EURUS
bietet anspruchsvollen Behandlerinnen und Behandlern bestmögliche Hygiene in kürzester Zeit.
Durch das Spülen der Instrumentenschläuche mit dem standardmäßig
installierten Instrumenten-Reinigungssystem in Verbindung mit
design, coupled with outstanding
reliability. The latest generation of
the successful EURUS model offers
practitioners the best possible hygiene in the shortest possible time.
Rinsing the instrument hoses with
the instrument cleaning system installed as standard in conjunction
with the flush out rinsing function
ensures safe treatment at all times
and prevents the formation of biofilms and bacterial growth in the
handpiece hoses. In addition, a suction hose cleaning system can be integrated as an option, which keeps
the suction hoses hygienically clean
and prevents contamination of all
kinds. The autoclavable handles and
der Flush out-Spülfunktion wird zu
jeder Zeit eine sichere Behandlung
gewährleistet und die Bildung von
Biofilmen und Bakterienwachstum
in den Schläuchen der Handstücke
vermieden. Zusätzlich lässt sich
als Option noch ein SaugschlauchReinigungssystem integrieren, wodurch die Saugschläuche hygienisch
sauber gehalten und Kontaminationen aller Art verhindert werden.
Die autoklavierbaren Griffe und
die Abdeckung der EURUS Operationsleuchte können nach Betätigen eines Hebels einfach abgenommen und sterilisiert werden. Natürlich kann die Einheit auch optional
mit einer Wasserentkeimungsanlage inklusive freier Fallstrecke,
einer Separierung, einem Amalgamabscheider oder einer Nassabsaugung ausgestattet werden.
Alle Features können Besucherinnen und Besucher der IDS 2023
live am Messestand erleben.
the cover of the EURUS operating
light can be easily removed and
sterilised after pressing a lever. Of
course, the unit can also be optionally equipped with a water sterilisation system including a free-fall section, a separation system, an amalgam
separator or a wet-suction system.
Visitors to IDS 2023 can experience all the features live at the trade
show booth.
LAON MEDI, South
Korea
www.laon-medi.com
Hall 2.2
Booth A018/B019
AD
THE GLOBAL DENTAL CE COMMUNITY
REGISTER FOR FREE
DT Study Club – e-learning community
www.dtstudyclub.com
@DTStudyClub
Tribune Group is an ADA CERP Recognized Provider. ADA CERP is a service of the American Dental Association to assist dental professionals in identifying quality providers of continuing dental education. ADA CERP does not approve or endorse
individual courses or instructors, nor does it imply acceptance of credit hours by boards of dentistry.This continuing education activity has been planned and implemented in accordance with the standards of the ADA Continuing Education Recognition Program (ADA CERP) through joint efforts between Tribune Group and Dental Tribune Int. GmbH.
When technically functional
Belmont quality meets high-end elegance, the result is EURUS. The innovative treatment unit from the
traditional Japanese company combines efficient treatment procedures,
contemporary comfort and elegant
40th International Dental Show 2023 • 14. März 14 March
Belmont Dental,
Germany
www.belmontdental.de
Hall 11.1
Booth G010/H019
[37] =>
untitled
Limited time offer!
Visit us at Hall 11.3 Stand G010-H029
Do you want to get rid of complicated
processes, save time and money?
Neoss® Digital Workflow
For over 20 years, Neoss has offered intelligent solutions that are intuitively easy to
use. Our products allow dental professionals to provide reliable and cost-effective
treatments to their patients with predictable long-term results. Utilizing our simple
digital workflow into your daily practice will save you time and money, while
increasing predictability. It will help you deliver the best functional and esthetic
outcomes for your patients.
1. Predictable and simplified
implant treatment
6. Predictable
2. Simplified
long-term
esthetics
healing
3D
5. Digital
prosthetics
3. Digital
impression
4. Prosthetic
implant
Digital
workflow
Neoss GmbH
•
Im Mediapark 5b
•
50670 Köln
•
T +49 221 96980 10
•
E neoscan.support.de@neoss.com
[38] =>
untitled
industry
38
BISCO’S TRIED AND TRUE CALCIUM-RELEASING FAMILY
Remember the adage “A penny
saved is a penny earned”? How about
“Little strokes fell great oaks”? It is
time to add another adage to the list:
“If it works, keep using it”. Whereas
this saying has countless uses in everyday life, it is particularly applicable
to work in the dental community.
Here, when something is efficient and
reliable, we turn to it time and time
again. That is why dentists across the
country continue to rely on the BISCO
line of therapeutic, calcium-releasing
materials for their restorative needs.
The newest addition to this family
of products, launched last year, is
TheraBase—a dual-cure, calcium- and
fluoride-releasing, self-adhesive base/
liner designed to be stronger and more
durable than other base materials.
Here is how it works: when water
is introduced, the non-dissolving
matrix releases calcium hydroxide
and fluoride ions. Then, within minutes, the ongoing ion exchange that
results raises pH levels,* and the
ensuing alkalinity promotes pulp vitality.1 TheraBase is dual-curing, which
means that, even though it can be
light cured, the material can fully
polymerise chemically throughout,
and this includes the area in deep
restorations where light cannot reach.
The calcium-releasing base and liner
features BISCO’s proprietary hydrophilic matrix, which aids in protecting
tooth structure. In addition, the material is self-adhesive and does not require bonding agents, thus saving time
and costs.
A much touted benefit is that
TheraBase is highly radiopaque, paving the way for improved radiographic identification and more accurate
dental diagnoses. The product also
has high flexural strength, absorbing
stress and shock from occlusal forces.
Well suited for pulpitis risk
“I’ve been using TheraBase when
I am very near to the pulp and where
there’s a risk of pulpitis,” Dr Aliisha
Choucair, a dentist at Laurel Dental in
Leander in Texas, explained. “It’s very
easy to place and has good retention
I was able to restore a case that had
reversible pulpitis—the tooth remained
vital, the nerve settled down, and the
restoration appears to be well sealed,”
she continued. “I like the science behind it—releasing calcium and fluoride—
and it has good handling properties.”
BISCO packages TheraBase in
a dual-barrel syringe that includes
Auto-Mix Cannula Tips, enabling an
accurate and always steady material
supply as well as simple, accurate
delivery with very little waste.
Dr Leo Huck, the owner of Huck
Dental in Wauwatosa in Wisconsin,
commented that he thoroughly enjoys
the product and said, “Having used it
for many restorations now, I have
found it just works wonderfully.”
Meet the rest of the family
TheraBase joins three other
Thera products, which all use the
THERA technology in their formulas.
TheraCal PT, for example, is a biocompatible, dual-cured, resin-modified calcium silicate that is used for pulpotomy treatment.
Dr David Martin, a dentist in
Totowa in New Jersey, said that TheraCal PT is particularly useful in cases
where patients cannot tolerate long
chair times. The material has a working time of 45 seconds and a setting
time of 5 minutes. “I recently had a
young child with a large carious exposure,” he explained. “I was able to
treat the lesion in a much quicker
time frame, resulting in a more pleasant appointment for the child as well
as an excellent final restoration.”
Moisture-tolerant and requiring fewer steps compared with other similar materials, TheraCal PT resists
breakdown and provides a durable
seal. It is also radiopaque and allows
for immediate placement of the restorative material. “Being able to place in
the presence of some moisture makes
it close to an ideal material for pulpotomies,” Dr Martin added.
Released in 2017, TheraCem is
a dual-cured, calcium- and fluoridereleasing, self-adhesive resin cement
that contains MDP, an adhesionpromoting monomer that enhances
bond strength to zirconia, metal and
tooth structure without the need for
additional adhesive or primer.
BISCO’s unique line of Thera products traces its lineage back to 2011,
when the first member of the Thera
family, TheraCal LC, was launched.
This light-cured product is a resinmodified, calcium silicate-filled liner.
TheraCal LC insulates the
pulp by forming a protective barrier against
thermal changes.2,3 Its
significant calcium release**
also leads to a protective
seal.2,4,5
For BISCO, building on
the success of each product
means its 40-year journey
will continue to evolve as
dental practices throughout
the world make the Thera
family of products their
go-to solution for all their
restorative needs.
* BISCO has on file the pH data
for TheraBase.
** BISCO has on fi le the calcium
release data for TheraCal LC.
Editorial note: A list of references is available from the publisher. This article first appeared
in Dental Product Shopper.
BISCO, USA
www.bisco.com
Hall 11.3
Booth E028
1
2
1: TheraBase. 2: TheraCem. 3: TheraCal LC.
AD
40th International Dental Show 2023 • 14. März 14 March
3
[39] =>
untitled
DRUCKLUFT
|
ABSAUGUNG
|
BILDGEBUNG
|
ZAHNERHALTUNG
|
HYGIENE
Bis zu 75% weniger Energieverbrauch*
Nachhaltigkeit und Skalierbarkeit mit den Tyscor Saugsystemen
Monitoring und Fernwartung
durch VistaSoft Monitor
reduziert CO2-Emissionen.
Radialverdichter reduziert
Energieverbrauch
um bis zu 75 %.*
Wächst mit der Praxis mit: Von
zwei bis zwölf Behandler,
ohne Austausch der Maschine.
Nachhaltige Produkte von Dürr Dental.
Mit unseren Tyscor Saugsystemen gehen wir den nächsten Schritt in eine nachhaltige Zukunft.
Damit machen wir nicht nur unsere Produktionskette nachhaltiger, sondern auch Ihre Praxis.
Mehr unter www.duerrdental.com
*gemessen an der Tyscor VS 4 und einem vergleichbaren Seitenkanalverdichter durch das Fraunhofer Institut
[40] =>
untitled
industry
40
DREAMTEAM ZUR SICHEREN INSTRUMENTENAUFBEREITUNG
Ob zur Vorbereitung oder finalen
Reinigung und anschließender Desinfektion – die manuelle Aufbereitung des zahnärztlichen Instrumentariums sollte eine hohe Materialverträglichkeit garantieren. BIB
forte eco von ALPRO MEDICAL vereint genau diese Anforderungen.
Das aldehyd-/phenol- und QAVfreie Flüssigkonzentrat BIB forte
eco ist perfekt abgestimmt und
dank der besonderen Eigenschaften universell sowohl für alle zahnärztlichen Instrumente, auch rotierende Instrumente, einsetzbar.
Bei der Desinfektion schützt
BIB forte eco ohne Proteinfixierung
durch seine Materialschutzformel
auch korrosionsempfindliche Instrumente vor Beschädigung, sogar
im Falle höherer Anwendungskonzentration oder bei Überschreitung der Einlegezeiten im Reinigungs- und Desinfektionsbad. Das
Universalprodukt für das allgemeine Instrumentarium und für
Bohrer kann mit hervorragender
Materialverträglichkeit auftrumpfen und ist dank seiner wirtschaftlichen Anwendung nicht nur umweltschonend, sondern auch preislich unschlagbar. Bei BIB forte eco
ist eine bakterizide (inklusive TBC
und MRSA), levurozide und nach
RKI (begrenzt viruzid PLUS) viruzide Wirksamkeit gegeben: kraftvoll gegen Keime, sanft zum
Material. Sicher, sauber,
ALPRO.
ALPRO
MEDICAL,
Germany
www.alpro-medical.de
Hall 11.2
Booth
N008/O009
QUALITÄT ERLEBEN UND MITGESTALTEN
EXPERIENCE QUALITY AND BE PART OF THE DESIGN PROCESS
Müller-Omicron ist ein deutscher
Hersteller von hochwertigen Silikonen für die Zahnarztpraxis und das
Dentallabor. Auf der diesjährigen
IDS bietet Müller-Omicron Anwenderinnen und Anwendern erstmalig
die Möglichkeit, bei der Produktentwicklung aktiv mitzuwirken. Wie
das genau funktioniert, erfähren
Besucherinnen und Besucher am
Messestand. Es dürfte ein „duftes“
Erlebnis werden, so der Hersteller.
Ein weiteres Highlight sind die
transparenten A-Silikone, die durch
höchste Transparenz für eine perfekte visuelle Kontrolle und Lichtdurchlässigkeit sorgen. kristall
PERFECT A70 mit seiner hohen Präzision, Shore-Härte und Reißfestigkeit findet in der Zahnarztpraxis Anwendung als Bissregistriermaterial
und Silikonschlüssel zur schnelleren
und einfacheren Seiten- und Frontzahnrestauration mit Kompositen so-
wie Übertragung von Brackets vom
Modell auf die Zähne. Die Laborvariante kristall PERFECT LAB A70 wird
zur Anfertigung von temporären Kronen oder Veneers eingesetzt. Beide
Materialien erleichtern und verkürzen
den Fertigungsprozess und gewährleisten eine optimale Sichtkontrolle
und sichere Polymerisation durch
die präzise Abformung hindurch.
Neben der Demonstration der
klassischen Abformsilikone sind auch
alle Desinfektionsmittel am Stand
erlebbar – im speziellen die Flächendesinfektionstücher Dentalrapid SD
wipes. Erleben Sie Qualität live. Ein
Besuch lohnt sich in jedem Fall.
Müller-Omicron is a German manufacturer of high-quality silicone impression materials for dental practices and laboratories. At this year’s
IDS, Müller-Omicron offers users the
opportunity to actively participate in
its product development. More details will be revealed at the booth.
Another highlight are the transparent A silicones, which allow for
perfect visual inspection and translucency owing to their high transparency. Owing to its high precision,
Shore hardness and tear resistance,
kristall PERFECT A70 is used in dental practices as a bite registration material and silicone key for faster and
easier posterior and anterior restorations with composites as well as
transfer of brackets from the model
onto the teeth. The laboratory version
kristall PERFECT LAB A70 is used
for the fabrication of temporary
crowns or veneers. Both materials facilitate and shorten the fabrication
process and ensure optimal visual
control and safe polymerisation
through precise impression.
In addition to the demonstration
of the classic impression silicones,
all disinfectants, and the surface disinfection wipes Dentalrapid SD wipes
in particular, will be on display. Experience quality live. A visit is worthwhile in any case.
Müller-Omicron, Germany
www.mueller-omicron.com
Hall 4.2
Booth H090/I091
FDI WORLD DENTAL CONGRESS 2023 KEHRT ZURÜCK ALS PRÄSENZVERANSTALTUNG MIT HOCHMODERNEM PROGRAMM UND
NETWORKING-MÖGLICHKEITEN FDI WORLD DENTAL CONGRESS 2023 RETURNS IN PERSON WITH STATE-OF-THE-ART SCIENTIFIC
PROGRAMME AND NETWORKING OPPORTUNITIES
Nach vier Jahren virtueller Veranstaltungen kehrt der Flaggschiffkongress des Weltverbandes der
Zahnärzte FDI zu seinem Präsenzformat zurück. Der FDI World Dental Congress 2023, der gemeinsam
mit der Australian Dental Association (ADA) veranstaltet wird, findet
vom 24. bis 27. September in Sydney
in Australien statt und bietet ein
hochmodernes wissenschaftliches
Programm mit Hunderten von akkreditierten Fortbildungsveranstaltungen und interaktiven Foren. In
der umfangreichen Ausstellung des
Kongresses können sich Teilneh-
mende über die neuesten Produkte,
Technologien und Trends in der
Zahnmedizin informieren.
Forscherinnen und Forscher
werden gebeten, bis zum 3. April
ihre Kurzfassungen für mündliche
Präsentationen oder E-Poster einzureichen, um ihre Originalstudien
oder Fallberichte vor führenden
Persönlichkeiten der Zahnmedizin
zu präsentieren. Die Abstracts dürfen nur in englischer Sprache verfasst und präsentiert werden, und
das Thema muss in eine der folgenden Kategorien fallen: allgemeine
Zahnheilkunde, präventive Zahn-
heilkunde, zahnärztliche Behandlung
und restaurative Zahnheilkunde sowie Oralchirurgie, Medizin und Krebs.
Interessierten wird empfohlen, die
Regeln und Kriterien im Detail zu
lesen, bevor sie ein Abstract einreichen.
Zahnärztinnen und Zahnärzte
sollten sich diese Gelegenheit nicht
entgehen lassen, um in der pulsierenden und vielfältigen Stadt Sydney mit Kolleginnen und Kollegen
Kontakte zu knüpfen und Wissen
über Mundgesundheit und Zahnmedizin auszutauschen. FDI und ADA
freuen sich darauf, die Kongressteil-
nehmenden in Australien begrüßen
zu dürfen.
Das vorläufige Programm sowie
Informationen zu Anmeldung, Anreise und Unterkunft finden Sie unter world-dental-congress.org.
After four years of virtual events,
FDI World Dental Federation’s flagship congress is returning to an
in-person format. The 2023 FDI World
Dental Congress, hosted jointly with
the Australian Dental Association
(ADA), will take place from 24 to
27 September in Sydney in Australia
and will offer a state-of-the-art scien-
40th International Dental Show 2023 • 14. März 14 March
tific programme featuring hundreds
of continuing professional education-accredited sessions and interactive forums. Attendees can explore
the latest products, technologies and
trends in dentistry at the congress’s
extensive exhibition.
Researchers are invited to submit
their abstracts for oral presentations
or e-posters by 3 April for the opportunity to present their original studies or case reports in front of leading
figures in the oral health community.
Abstracts must be prepared and presented in English only, and the topic
must fall into one of the following categories: general dentistry; preventive
dentistry; dental treatment and restorative dentistry; and oral surgery,
medicine and cancer. Those interested are advised to review the rules
and criteria in detail before making a
submission.
Dental professionals should not
miss this opportunity to network and
exchange knowledge on oral health
and dentistry with peers and colleagues in the vibrant and diverse
city of Sydney. FDI and the ADA look
forward to welcoming congress attendees to Australia.
The preliminary programme and
information on registration, travel and
accommodation can be found at
world-dental-congress.org.
FDI World Dental
Federation, Switzerland
www.fdiworlddental.org
Hall 11.2, Booth N069
[41] =>
untitled
[42] =>
untitled
industry
42
BEHANDLUNG VON CMD UND SCHLAFSTÖRUNGEN: ATEM- UND MYOFUNKTIONELLE TECHNIKEN IN DER KIEFERORTHOPÄDIE
TREATMENT OF TMJ AND SLEEP DISORDERS: BREATHING AND MYOFUNCTIONAL TECHNIQUES IN ORTHODONTICS
Kieferorthopädische Behandlungen mit Alignern und frühen Interventionen, die integrierte Behandlung
von Atemfluss- und Kiefergelenkproblemen, myofunktionelle Therapie und zahnärztliche Schlafmedizin
erfreuen sich zunehmender Beliebtheit. Kein Wunder also, dass sowohl
in der Klinik als auch patientenseitig eine nie dagewesene Nachfrage
nach solchen Therapien besteht.
Voller Stolz präsentiert Myofunctional Research (MRC) auf der IDS
2023 seine neuesten Entwicklungen.
Unser Fokus liegt seit drei Jahrzehnten auf der Herstellung myofunktioneller Apparaturensysteme, und unsere
breite Produktpalette bietet medizinischem Fachpersonal auf der ganzen
Welt einfache und effektive Lösungen
zur Implementierung dieser Techniken.
Die moderne Kieferorthopädie ist
stets auf der Suche nach einfacheren
Lösungen für die Behandlung der
orofazialen Muskulatur. Mit der neu
entwickelten myofunktionellen TLJTrainingsapparatur [tounge, lip & jaw]
von MRC können nun problemlos
auch während der Behandlung mit
einer festen Zahnspange Kraft und
Tonus von Zunge, Lippen, Kiefer- und
Halsmuskulatur verbessert werden.
Wir präsentieren außerdem die erweiterte Apparaturenserie Myobrace
für Klasse III, die nun drei Stufen für das
Dauergebiss umfasst und den Schwerpunkt auf die Korrektur von Habits,
die Entwicklung des Zahnbogens sowie
die Finishing-Phase und Retention legt.
Myosa, das neueste Behandlungssystem von MRC, ermöglicht eine
einfache, integrierte Behandlung von
Atmungs- und myofunktionellen Störungen sowie craniomandibulären Dysfunktionen (CMD). Myosa für Kinder
ist ein zweistufiges System für Kinder zwischen drei und 15 Jahren, das
zunächst für einen ungehinderten
Atemluftstrom sorgen und anschließend die Nasenatmung und die korrekte Myofunktion etablieren soll.
Mit dem Relaunch der dreistufigen Apparaturenserie Myosa für
TMJBDS [temporomandibular joint,
breathing and myofunctional disorders]
präsentieren wir die neuesten Verbesserungen an diesem System. Ergänzt werden die Apparaturen durch
die neuen Apps Myosa Consultation
und Myosa Activities. zwei wertvolle
Ressourcen für die Patientenschulung
und die Verbesserung der Compliance.
Darüber hinaus erweitert MRC
seine Online-Lernplattform www.
myoresearch.com um einen weiteren
Kurs zum Behandlungssystem Myosa
für TMJBDS. Auf dieser Website lernen Behandelnde in kürzester Zeit,
wie sich unsere Systeme in ihren klinischen Alltag einbauen lassen.
Besuchen Sie uns auf der IDS.
Heben Sie sich mit MRC-Apparaturen
vom Angebot der breiten Masse ab.
Demand for aligner and early intervention orthodontics, integrated airway
and temporomandibular joint treatment, myofunctional therapy and dental sleep disorder treatment is booming,
and Myofunctional Research (MRC) is
proud to unveil its latest developments
in the field at IDS 2023. Our commitment to producing revolutionary myofunctional appliance systems spans
three decades, and our broad range
of products continues to empower
healthcare professionals globally to
find simple and effective solutions for
implementing these techniques.
Modern orthodontic providers
seek simpler solutions to treat the
orofacial muscles. MRC’s release of
a tongue, lip and jaw appliance for
braces allows practitioners to improve the strength and tone of the
tongue, lips, mandibular and throat
muscles effortlessly while using orthodontic appliances.
We are also proud to expand the
Myobrace for Interceptive Class III
appliance group with the creation of
a three-stage appliance system for the
permanent dentition, which is focused
on habit correction, arch development, final alignment and retention.
Myosa treatment system
Myosa is MRC’s latest treatment
system allowing for the simple, integrated treatment of breathing disorders,
myofunctional disorders and temporomandibular joint disorders. For ages three
to 15, Myosa for Kids is now a twostage appliance system that establishes
functional airway and nasal breathing
and corrects poor breathing habits.
Recent enhancements made to the
Myosa for temporomandibular joint,
breathing and myofunctional disorders
(TMJBDS) appliance group will also be
showcased with the relaunch of the
three-stage system. Accompanying the
appliances will be the new Myosa consultation and activities supplementary
resources, which are invaluable tools
AD
40th International Dental Show 2023 • 14. März 14 March
for educating patients and improving
compliance.
Furthermore, MRC is proud to add
yet another course to its online learning platform, focusing on the Myosa
for TMJBDS system. Practitioners are
encouraged to use the website to learn
how to implement the systems into their
clinics in little to no time.
Visit our booth at IDS to differentiate your practice by offering MRC’s
appliances.
Myofunctional
Research, Australia
www.myoresearch.com
Hall 11.3
Booth E030/F031
[43] =>
untitled
edelweiss SYSTEMS
VENEER
OCCLUSIONVD
COMPOSITE
POST & CORE
PEDIATRIC CROWN
CAD/CAM BLOCK
edelweiss CAD/CAM BLOCK
T-BLOCK/C-BLOCK/i-BLOCK
Glas s: S i & B a
AIO
ZnO
Ca r b o n
Fluoride
Smooth inorganic surface
w i th o u t v i s i b l e c o m p o s i te s tr u c tu re
Laser sintering /
vitrification process
SEM
e d e l we i s s
SEM
a l te r n a te
Dr. Marco Tudts
DDS, MScD
“The difference lies in the
high similarity with nature.”
EDELWEISS
ADVANTAGES
• Ultrafine sintered glass
microstructure combines high
strength with permanent high
gloss
• Shorter milling time
• Kinder to the milling burs
• No additional firing required,
simply polish and cement
ALTERNATIVE
• Simple cementation procedure
with proven perfect seal
• Cost saving, faster processing
time reduces chairside time
• Biomechanical and biocompatible
• Esthetically superior, life-like
appearance
• Restoration can be easily
finetuned or repared by the
dentist
SPLIT MOUTH CLINICAL STUDY
After 4 weeks: edelweiss VENEERs
maintain its original gloss and anatomy.
Alternate veneers look dull and start to
chip, with loss of its surface texture.
Scratches appear on the surface of
the alternate veneers as a result of tooth
brush abrasion while the edelweiss
VENEERs has its original shine.
Convince yourself and tr y our products at a live hands-on station at the edelweiss booth.
We are happy to welcome you at Hall 11.3, Stand D040 – E041.
www.edelweissdentistr y.com
[44] =>
untitled
industry
44
DIGITALE LÖSUNGEN IN PREMIUM-QUALITÄT: VOM INTRAORALSCAN BIS ZUM 3D-DRUCK
PRIME DIGITAL SOLUTIONS: FROM INTRA-ORAL SCANNING TO 3D PRINTING
Zum ersten Mal präsentiert Dentsply
Sirona zwei digitale Produktlösungen
vor einem großen internationalen
Messepublikum, die für Zahnarztpraxen und Dentallabore mehr Einfachheit und Effizienz sowie hervorragende Ergebnisse liefern – Primescan
Connect und Primeprint Solution.
Beide sind Teil des neuen „Digital
Universe“, das auch die Plattformlösung DS Core als Tor zu allen
neuen Dienstleistungen und Technologien umfasst.
Primescan Connect ist die Laptop-basierte Version von Primescan,
dem intuitiv zu bedienenden, schnellen und präzisen Intraoralscanner
von Dentsply Sirona. Auf diese Weise
wird ein einfacher Einstieg in die digitale Zahnmedizin möglich. Primescan
Connect bietet eine moderne und
hochgradig vernetzte 3D-Scantechnologie bei einem vergleichsweise
geringen Investment (verglichen mit
CEREC Primescan).
Primescan Connect kann für alle
digitalen Arbeitsabläufe bei restaurativen Indikationen, in der Implantologie und Kieferorthopädie sowie
im Herstellungsprozess von Protrusionsschienen verwendet werden.
IDS-Besucherinnen und -besucher
sind eingeladen, das Scannen am
Stand selbst auszuprobieren.
Primeprint Solution als hoch automatisiertes, professionelles 3D-Druck-Komplettsystem, das Digital Light
Processing nutzt, ermöglicht mit
einem vereinfachten und automatisierten Druckprozess die einfache
Herstellung von biokompatiblen Anwendungen mit reproduzierbaren
und genauen Ergebnissen,1 zum Beispiel von Bohrschablonen, Aufbissschienen, provisorischen Versorgungen und Arbeitsmodellen. Deren
Herstellung wird in Live-Demos direkt am IDS-Messestand gezeigt.
Diese intelligente Hard- und Softwarelösung ist für zahnmedizinische
Primescan Connect, die Laptop-basierte Version von Primescan.
Primescan Connect—the laptop-based version of Primescan.
Anwendungen optimiert und bildet
den gesamten Druckprozess einschließlich der Nachbearbeitung ab,
die bisher komplexe, unsaubere und
zeitaufwendige Handarbeit bedeutete. Der hohe Automatisierungsgrad
kann dazu beitragen, die Bearbeitungszeiten zu verkürzen, erlaubt die
Delegation und sorgt für eine sehr
hohe Produktivität.
Der Druckprozess wurde in Übereinstimmung mit den Richtlinien der
U.S. Food and Drug Administration
für die additive Fertigung von Medizinprodukte entwickelt. Das Ergebnis sind Medizinprodukten für die
Anwendung im Patientenmund.
For the first time at a major international trade show, Dentsply Sirona
is presenting two digital product solutions, namely Primescan Connect
and Primeprint Solution, developed
to deliver greater simplicity, efficiency and outstanding results for
dental practices and laboratories.
Both solutions belong to the company’s new digital universe, which includes DS Core—an open cloudbased platform that serves as a
gateway to all new Dentsply Sirona
services and technologies.
Primescan Connect is the laptopbased version of Primescan—Dentsply
Sirona’s intuitive, fast and accurate
intra-oral scanner that facilitates entry
to digital dentistry. Primescan Connect
offers advanced and highly connected
3D-scanning technology for a relatively
OSSTEM IMPLANT WILL MIT KS-IMPLANTAT UND SOI-OBERFLÄCHENTECHNOLOGIE EUROPÄISCHEN MARKT EROBERN
OSSTEM IMPLANT TARGETS THE EUROPEAN MARKET WITH KS IMPLANT
AND SOI NEXT-GENERATION SURFACE TECHNOLOGY
Als Ergebnis seiner vierjährigen
Forschungs- und Entwicklungsarbeit
hat OSSTEM IMPLANT das KS-Implantsystem auf den europäischen
Markt gebracht. Es weist eine 2,4-mal
höhere Dauerbruchfestigkeit als bestehende Produkte auf. Die Festigkeit wurde verbessert, indem der
Durchmesser der Schraube, die das
Implantat und das Abutment verbindet, um 0,4 mm verringert – von
2,0 auf 1,6 mm – und damit die
Wandstärke erhöht wurde.
Super Osseointegration (SOI),
eine von OSSTEM entwickelte Oberflächentechnologie, beschichtet die
Implantatoberfläche mit einer Substanz, die die Aktivierungsenergie
der Oberfläche aufrechterhält und
die anfängliche Osseointegrationszeit im Vergleich zu bestehenden Implantatoberflächen-Technologien
um mehr als 35 Prozent verkürzt.
Dadurch kann der Zeitraum der
Implantatbehandlung, der bis zu
sechs Monate dauert, auf ein oder
zwei Monate verkürzt werden.
After four years of research and
development, OSSTEM IMPLANT has
released the KS implant system, which
is now on sale in European markets.
This implant has 2.4 times the fatigue and fracture strength of existing products. The strength was im-
proved by reducing the diameter of
the screw connecting the implant
and abutment by 0.4 mm, from 2.0 to
1.6 mm and thereby increasing the
wall thickness.
Super Osseointegration (SOI), a
surface technology developed by
OSSTEM, coats the implant surface
with a substance that maintains the
surface activation energy, reducing
the initial osseointegration period by
more than 35% compared with ex-
iswting implant surface technology.
Consequently, the implant healing period, which normally takes up to six
months, can be reduced to just one or
two months.
OSSTEM IMPLANT,
South Korea
en.osstem.com
Hall 1.2
Booth A030/C039
Yoon Ji-Hoon, Leiter des OSSTEM IMPLANT Research Institute, und weitere Forscher die das
TS-Implantat des Unternehmens betrachten.
Y
oon Ji-Hoon, director of the OSSTEM IMPLANT Research Institute, and fellow researchers looking at the company’s TS implant.
Primeprint Solution ist ein hoch automatisiertes, professionelles 3D-Druck-Komplettsystem,
das Digital Light Processing nutzt.
Primeprint Solution is a highly automated complete 3D-printing system that uses digital light processing.
modest investment (compared with
CEREC Primescan).
Primescan Connect can be used in
all digital workflows for the production of restorations, in implantology
and orthodontics, as well as for the
fabrication of mandibular advancement devices. Visitors to IDS are invited to try scanning with Primescan
Connect for themselves at Dentsply
Sirona’s booth.
Primeprint Solution is a highly
automated complete 3D-printing system that uses digital light processing
and enables easy fabrication of biocompatible appliances with reproducible and accurate results1 based on a
simplified and automated printing
process. Its applications include surgical guides, bite guards, temporary
restorations and working models. Visitors to IDS are invited to join live
demonstrations of the manufacturing
process at the company’s booth.
This intelligent hardware and software solution is optimised for dental
applications and runs the entire printing process, including post-processing,
thus reducing complex, messy and
time-consuming manual work. The
high level of automation can help to
reduce processing times, allows delegation and ensures the highest possible productivity.
The printing process was developed in compliance with the U.S. Food
and Drug Administration’s guidance
on additive manufacturing of medical
devices. The result is medical devices
for use in the patient’s mouth.
1
Reich S, Berndt S, Kühne C, Herstell H. Accuracy of 3D-printed occlusal devices of different volumes using a digital light processing
printer. Appl Sci (Basel). 2022;12(3):1576. doi:
10.3390/app12031576.
Dentsply Sirona, USA
www.dentsplysirona.com
Hall 11.2
Booth K010/K051
POWER STEAMER VON RENFERT:
DAMPFSTRAHLER SETZT NEUEN MASSSTAB IN
PUNCTO ZUVERLÄSSIGKEIT
Renfert bringt mit dem POWER
steamer seinen ersten Dampfstrahler auf den Markt. Der neue Dampfstrahler zeigt, wie intelligentes Engineering richtig funktioniert.
Ausgeklügelt bis ins feinste Detail
wird der POWER steamer zum echten Performance-Meister.
Mit dem POWER steamer betreten Dentallabore beim Abdampfen
ein neues Level. Der Dampfstrahler
mit wartungsfreiem Heizelement
und intelligentem Engineering ergänzt die Laborausstattung mit smarten Funktionen, ansprechendem Design und verlässlicher Dampfleistung.
Herzstück ist der Kessel, in dem das
Heizelement im Aluminiumboden
vergossen ist. Damit ist ein echter Ingenieursstreich gelungen, der das
Heizelement nahezu unverwüstlich
macht.
Dank konstantem Druck (4,5 bar)
in Kombination mit der IT-Düse
(Intelligent-Technologie) werden Werkstückoberflächen gründlich gesäubert. Die IT-Düse bewirkt einen fokussierten Dampfstrahl; der POWER
steamer hat somit eine vergleichbare effektive Reinigungsleistung
wie Geräte mit 5 oder 6 bar Arbeitsdruck, schont aber zugleich die
Werkstückoberfläche. Die leistungsstarke Heizung sorgt für eine kurze
Aufheizzeit bzw. ein schnelles, permanentes Nachheizen. Intelligentes
Engineering gewährleistet den Dauer-
40th International Dental Show 2023 • 14. März 14 March
betrieb. Weiteres raffiniertes Detail:
Die extragroße Revisionsöffnung im
Druckbehälter steht für ein komfortables Spülen und Entkalken.
Mit Volldampf durch den Laboralltag – selbst bei hoher Frequentierung bewahrt das Gerät volle Power.
Zudem machen anwenderfreundliches Handling und gewohnte RenfertServices aus einem einst biederen
Alltagsgerät (Dampfstrahler) den
POWER steamer. Alle Komponenten
haben die gewohnt hohe RenfertQualität. Hier treffen verlässliche
Ingenieursleistung und ausgeklügelter Anwendungskomfort auf
zahntechnische Expertise.
Renfert, Germany
www.renfert.com
Hall 10.1
Booth B010/C019
[45] =>
untitled
)%0GY#CFXC+15
YKVJVJGWPKSWG&46GEJPQNQI[v
r 5NKOUOCNNCPFNKIJVJCPFRKGEGHQT
GCU[CEEGUUVQFKHƂEWNVCTGCU
r #WVQENCXCDNGVKRHQTHWNNETQUU
KPHGEVKQPEQPVTQN
r FKOGPUKQPCNTGITGUUKQP &4 VQ
QXGTEQOGEJCNNGPIGUQHTGƃGEVKQPU
UCNKXCCPFVTCPUNWEGPEKGU
r %QORCEVCPFOQDKNGUECPPKPI
U[UVGOYKVJUKPINGECDNG
EQPPGEVKXKV[
r 5OCTVUECPUVCTVLWUVRKEMKVWR
)%'7412'08
KPHQIEG"IEFGPVCN
JVVRU YYYIEFGPVCNGWTQRG
[46] =>
untitled
industry
46
SHINING 3D SHARES COMPLETE WORKFLOW SOLUTIONS AND MAJOR ANNOUNCEMENTS
SHINING 3D focuses entirely on 3D-digitising and 3D-printing solutions, developing a full
suite of digital products for both dental clinics
and dental laboratories. The SHINING 3D portfolio aims to offer a complete solution covering
the needs of both clinics and laboratories, includ-
ing intra-oral and desktop 3D scanners and digital light processing and liquid crystal display
3D printers.
The exhibition will be a great opportunity to
have a closer look and to discover SHINING 3D’s
complete workflow. Powerful, efficient and user-
friendly solutions will be showcased, and attendees
will be able to discover news from SHINING 3D
exclusively at IDS.
Among the technology on display will be the
AccuFab-L4D—a large-platform 3D printer with
4K resolution that supports the printing of different types of professional dental appliances
and improves the efficiency of denture fabrication.
SHINING 3D’s Aoralscan 3 intra-oral scanner improves the overall clinical experience
with its powerful and intelligent data processing
capabilities. The scanning speed and the accuracy of the previous model have been improved
by up to 30%, allowing for better results.
AutoScan-DS-EX Pro(H) is the latest addition to SHINING 3D’s portfolio of desktop scanners. It is equipped with dual 5 MP cameras,
achieving a scanning accuracy of ≤ 8 μm and
thus satisfying the requirement of various applications in the dental industry.
This year, SHINING 3D will be making some
big announcements, such as the debut of its first
wireless intra-oral scanner, Aoralscan 3 Wire-
less, which provides freedom from constraints
and secondary contamination, thus enhancing
the whole treatment experience. It includes
a fast-heating scanning tip, greatly reduces
post-processing time and boasts an outstanding
power supply, among its many great features.
MetiSmile is SHINING 3D’s first self-developed and manufactured facial scanner for dental applications. It can quickly capture facial information for 3D modelling in vivid texture and
features mandibular movement tracking and facial measuring functions.
Fabwash is a multistage part-releasing,
washing and drying system built to deliver the
ease of use, consistency, speed and cleanliness
demanded by dental clinics employing 3D printing.
SHINING 3D Technology,
Germany
www.shining3ddental.com
Hall 3.1, Booth K040/L049
DMP DENTAL: CREATE BRIGHT SMILES
DMP has more than 35 years of experience in dental material manufacturing, and the company successfully
supplies the dental market worldwide,
achieving top quality and reliability
through the integrity, passion and commitment ingrained in DMP’s culture.
DMP is best known for BONASIL—its
broad range of silicone impression
materials—and for its BRIGHT line of
aesthetic filling materials. DMP aims
to create bright smiles and to provide
the highest level of satisfaction by
closely cooperating with its customers and maintaining a high degree of
flexibility in catering for individual
market needs.
Leading DMP’s BRIGHT range of
composites is NANOCERAM-BRIGHT,
a nano-hybrid composite formulated
with a special blend of nano- and microfillers. Its superior aesthetics result
from an advanced method of integrating the nanoparticles in the resin ma-
trix. The size of the nanoparticles permits a rapid polish after polymerisation and exhibits very low wear in the
long term. NANOCERAM-BRIGHT’s
excellent non-sticky handling is complemented by its ease in sculpting
with no slumping. The high filler loading, combined with fine particle size
distribution, leads to superior marginal integrity and eliminates microleakage while minimising postoperative sensitivity.
Tooth interface longevity is further enhanced by low polymerisation
shrinkage and high flexural strength.
The composite filler contains a scientifically developed blend of opaque
and translucent components in order
to assure a normal vitality. It has sufficient opacity to mask darkness and
enough translucency to offer a vibrant,
natural appearance. NANOCERAMBRIGHT’s chameleon effect, along with
a comprehensive range of restorative
tints, offers excellent shade matching
for restorations. During the finishing
and polishing stages of a resin restoration, the filler particle size makes it
possible to achieve a high-gloss surface quickly and easily.
DMP Dental, Greece
www.dmpdental.com
Hall 10.1
Booth B028/C029
CEPPRO: EVOLVING BEYOND DIGITAL ORTHODONTIC DIAGNOSIS
DDH seeks to increase clinical utilisation of
digital dentistry by developing digital dentistry
solutions and services that employ artificial intelligence (AI) and providing these through its
digital dentistry platform. Currently, more than
350 member clinics in South Korea use its online AI-based orthodontic diagnosis support
solutions and clear aligner services.
DDH’s CEPPRO is a cloud-based automated
cephalometric analyser and real-time orthodontic diagnosis support solution developed
1
through AI learning on extensive clinical data.
Being an online service, CEPPRO is more convenient and efficient than traditional installed
software and offers high cost-effectiveness.
It automatically identifies 78 cephalometric/
anthropometric landmarks on cephalometric images in real time, including 34 facial soft-tissue
landmarks and 44 hard-tissue landmarks. The
large number of landmarks detected supports accurate analysis of the clinical case and realistic
visualisation. CEPPRO also presents measure-
ment analysis results and has a visual treatment
objective function that automatically aligns the
cephalometric image with facial photographs and
optimises the envisioned soft-tissue changes after
hard-tissue movement. These features ensure a
real-time visualisation of treatment results for patient consultation, thereby increasing treatment
efficiency and acceptance at the same time.
CEPPRO has been certified by the Korea Ministry of Food and Drug Safety and obtained the
CE mark. It was developed through long-term
2
Figs. 1 & 2: CEPPRO 3.0.
40th International Dental Show 2023 • 14. März 14 March
research and development collaboration with
Seoul National University School of Dentistry.
Signing up for DDH free membership grants
immediate access to the software. Currently,
CEPPRO 2.01 is available free, and CEPPRO 3.0,
which is scheduled to launch in the first half of
this year, will offer a free trial period after
launch and a low monthly subscription fee option therafter. There is no need to purchase
expensive software licences or upgrades, and
CEPPRO provides on-demand service and the
most up-to-date version of the program. Users do
not need a high-performance computer, as
CEPPRO is a fast web-based service.
The upcoming Version 3.0 enhances userfriendliness and patient consultation functions
compared with the existing version, adds superimposition with the latest AI technology and applies more advanced AI functions to predict
treatment results.
DDH, South Korea
www.ddhinc.net/en/
Hall 4.2, Booth K079
[47] =>
untitled
industry
47
EXOCAD PRÄSENTIERT DIE HIGHLIGHTS VON DENTALCAD, EXOPLAN UND CHAIRSIDECAD
EXOCAD PRESENTS DENTALCAD, EXOPLAN AND CHAIRSIDECAD HIGHLIGHTS
ten Softwarelösungen von exocad
ermöglichen nahtlose Funktionalität im gesamten digitalen Workflow.
Wer mehr darüber erfahren
will, wie sich die Produktivität
mithilfe der führenden CAD/CAMSoftware steigern lässt, ist am
exocad-Stand genau richtig.
Exocad, an Align Technology
company, is presenting open-platform solutions at IDS 2023 under
the motto “Imagine the CADabilities”. “Our software experts will be
on-site to show the entire exocad
software package in use,” said
Novica Savic, chief commercial
officer and general manager at
exocad. Current software for dental
laboratories and practices include
DentalCAD, ChairsideCAD and
exoplan. All exocad software solutions blend seamlessly together and
can be built out with additional
modules. IDS visitors can look forward to new features in the new
3.1 Rijeka release series.
1
DentalCAD
Exocad’s DentalCAD is one of the
leading dental CAD software programs, thousands of licences being
sold each year. Specifically designed
for dental technicians, DentalCAD
offers productivity, flexibility and the
ability to create outstanding dental
restorations. With more than 45 new
and over 85 enhanced features, the
new 3.1 Rijeka release marks another
milestone in exocad’s continuous optimisation of workflows for increased
productivity.
ChairsideCAD
Based on exocad’s laboratory
software, DentalCAD, ChairsideCAD
is the first complete open-architecture
CAD software platform for single-visit
dentistry. The software includes a
step-by-step guide through the design
process, simple integrations with a
broad spectrum of devices and the
ability to seamlessly share information between clinicians and laboratories. ChairsideCAD users can take advantage of the integrated communi-
cation platform dentalshare to easily
collaborate with laboratories of their
choice.
Exoplan
Implantology is an integral part
of modern patient treatment. With
exoplan, dental laboratories, dentists, implant specialists and surgeons are guided from implant planning to surgical guide design and
manufacturing in one intuitive digital workflow. Exocad’s integrated
software solutions allow for seamless functionality across the digital
workflow.
For visitors who want to learn
more about how to increase productivity with the help of the leading
dental CAD/CAM software, the
exocad booth at IDS is the right
place to be.
exocad, Germany
www.exocad.com/ids
Hall 1.2
Booth A040/C041
AD
2
IDS News 2023
3
1: DentalCAD. 2: ChairsideCAD. 3: Exoplan.
Die exocad GmbH, ein Unternehmen von Align Technology, präsentiert auf der IDS 2023 ihre offenen Softwarelösungen unter dem
Motto „Imagine the CADabilities“.
„Unsere Software-Experten werden vor Ort sein und das gesamte
exocad-Softwarepaket im Einsatz
zeigen“, sagte Novica Savic, Chief
Commercial Officer und Geschäftsführer bei exocad. Zu den aktuellen Anwendungen für Dentallabore
und -praxen gehören DentalCAD,
ChairsideCAD und exoplan. Alle
Softwareanwendungen von exocad
greifen nahtlos ineinander und lassen sich mit zusätzlichen Modulen
erweitern. Die Besucher können
sich auf neue Funktionen in der
neuen Release-Serie 3.1 Rijeka
freuen.
Mission, Workflows zu optimieren
und die Produktivität zu steigern.
ChairsideCAD
ChairsideCAD ist die erste
komplett offene CAD-Softwareplattform, die Restaurationen – vom
Scan über das Design bis zur Fertigung – in nur einer Sitzung beim
Zahnarzt ermöglicht. Die Software
führt Anwender Schritt für Schritt
durch den Designprozess, lässt
sich mit einem breiten Spektrum
von Geräten integrieren und bietet
nahtlosen Informationsaustausch
zwischen Praxen und Laboren.
ChairsideCAD-Anwender können
die integrierte Kommunikationsplattform dentalshare nutzen, um
mühelos mit Laboren ihrer Wahl
zusammenzuarbeiten.
DentalCAD
Exoplan
DentalCAD von exocad ist eine
der führenden CAD-Softwareanwendungen für Labore. Speziell für Zahntechniker entwickelt, bietet DentalCAD Produktivität und Flexibilität
beim Design hochwertiger Zahnrestaurationen. Mit mehr als 45 neuen
und über 85 verbesserten Funktionen ist die neue Version 3.1 Rijeka
ein weiterer Meilenstein in exocads
Implantologie ist ein integraler Bestandteil der modernen Patientenbehandlung. Mit exoplan
werden Dentallabore, Zahnärzte, Implantatspezialisten und
Chirurgen von der Implantatplanung über das Design der Bohrschablone bis hin zur Fertigung
in einem intuitiven, digitalen
Workflow geführt. Die integrier-
CONTEC pro
Cytec
preorder your
IDS Starter Kit
in 6 sizes
since 2001
available approx. 08/2023
1RWLôHG%RG\&HUWLôFDWLRQLQSURJUHVV
Contec
in 5 sizes
since 2007
E. HAHNENKRATT GMBH | Fon +49 7232 3029–0 | info@hahnenkratt.com | www.hahnenkratt.com
[48] =>
untitled
THE NEW
DENTISTRY STANDARD
PreXion3D EXPLORER Series and EXPEDITION.
PreXion 3D CBCT combines precise imaging and low radiation with large
field of view capability and a first-of its kind incorporated cephalometric x-ray.
T DS
E
I
E
t
M Sa
59
0
U 1.1 58/B
ll 1 h A0
a
h ot
bo
EXPEDITION
Newly in house developed
IGZO FPD bulit in
EXPLORER PRO
The cephalometric x-ray
integrated without any
upgrade
EXPLORER
One of largest 15 x 16 cm FOV
without any stitching
prexion.co.jp
prexion.eu
prexion.com
PreXion Corporation (Japan) www.prexion.co.jp PreXion (Europe) GmbH (Germany) www.prexion.eu PreXion Inc. (USA) www.prexion.com
[49] =>
untitled
industry
49
IPS E.MAX CAD VON IVOCLAR – SCHNELLER ALS JE ZUVOR IPS E.MAX CAD FROM IVOCLAR—FASTER THAN EVER BEFORE
Seit mehr als 15 Jahren überzeugt IPS e.max
CAD Zahnärztinnen und Zahnärzte weltweit
und ist dank seiner klinisch bewährten Eigenschaften die weltweit am meisten verkaufte
Glaskeramik. Neben Langlebigkeit und hoher
Ästhetik zeichnet sich IPS e.max CAD durch
Effi zienz und Verlässlichkeit aus,1-3 und nun
wird IPS e.max CAD sogar noch schneller. Mit
dem Kombinationsofen Programat CS6 können IPS e.max CAD-Restaurationen nun in
nur 11 Minuten und 10 Sekunden kristallisiert
und glasiert werden – dank der innovativen
Technologie in der Brennkammer des Ofens.
Somit einfach auf der Restauration die
Spray-Glasur auftragen oder die Self GlazeTechnik (Poliertechnik) anwenden und die IPS
e.max CAD-Einzelzahnrestaurationen in einem Schritt im Programat CS6 kristallisieren. Der offen gestaltete Programat CS6 verfügt über eine neue, zum Patent angemeldete,
Vakuumtechnologie, die das Sintern von Zirkonoxid-Restaurationen, wie IPS e.max ZirCAD,
beschleunigt und hochästhetische Ergebnisse liefert.
IPS e.max CAD hat den Dentalmarkt bei
seiner Einführung 2005 revolutioniert. Seither
ist der legendäre blaue Block, das Lithiumdisilikat-Material, Zahnärztinnen und Zahnärzte vertraut. Die Restaurationen überzeugen
durch hohe Ästhetik mit einer Überlebensrate
von 97,2 Prozent über einen Zeitraum von
zehn Jahren.4 Die Zehn-Jahres-Garantie auf
IPS e.max-Restaurationen gibt Sicherheit.
Die hohe Biegefestigkeit von 530 MPa und
die Bruchzähigkeit von 2,11 MPa m½ machen
das Material so verlässlich.5,6 Das breite Anwendungsgebiet reicht vom dünnen Veneer,
über Kronen, Inlays, Onlays und Hybrid-
Abutment-Kronen7–9 bis zur dreigliedrigen
Brücke bis zum zweiten Prämolaren als endständigem Pfeiler. Restaurationen aus dem
hochfesten CAD/CAM Chairside-Material
können adhäsiv, selbstadhäsiv und sogar
konventionell befestigt werden.
Im Behandlungsablauf in der Praxis bieten
die Produkte von Ivoclar die passende Ergänzung für jeden Schritt: die Beratung mit
Ivoclar Smile, die relative Trockenlegung mit
OptraGate, IPS e.max CAD, der Programat CS6
oder die Befestigung mit Variolink Esthetic
sind alle perfekt auf die Bedürfnisse im Praxisalltag abgestimmt.
Das IPS e.max-Produktportfolio und weitere Innovationen von Ivoclar auf der IDS erleben.
For more than 15 years, IPS e.max CAD has
impressed dentists around the world. It has
become the world’s best-selling glass-ceramic
thanks to its clinically proven properties. In
addition to high aesthetics and durability, the
material is characterised by efficiency and reliability,1–3 and now, IPS e.max has become even
faster. With the Programat CS6 combination
furnace, IPS e.max CAD restorations can be
crystallised in just 11 minutes and 10 seconds—made possible by the innovative technology that is built into the firing chamber of the
furnace. This is simply done by applying glaze
spray to or using the self-glazing (polishing)
technique on the restorations, and then the IPS
e.max CAD single-tooth restorations can be
crystallised in a single step in the furnace. The
furnace is designed as an open system and features proprietary vacuum technology that accelerates the sintering process of zirconia res-
VARIOS COMBI PRO: DIE 2-IN1-PROPHYLAXE- UND PERIOKOMBINATION VARIOS COMBI PRO: 2-IN-1 COMBINATION FOR PROVIDING COMPREHENSIVE ORAL HYGIENE
Für eine umfassende Dentalhygiene ist
Varios Combi Pro von NSK genau die richtige
Wahl. Es vereint die zwei Systeme Ultraschall und Pulverstrahl in einer Einheit. Die
Kraft des Ultraschalls resultiert aus dem iPiezoMotor, der selbst bei hartnäckigem Zahnstein
eine stabile Frequenzausgabe ohne Leistungsabfall liefert. Für das Handstück steht
eine breite Auswahl an Scaling-Aufsätzen zur
Verfügung; auch für die Implantatversorgung
stehen Aufsätze zur Verfügung.
Die Kammern für die Pulverstrahlbehandlung lassen sich leicht von dem Gerät lösen
und wieder verbinden. Eine supragingivale
Kammer für Flash Pearl-Pulver auf Calciumcarbonat-Basis zum Entfernen hartnäckiger
Verfärbungen und eine subgingivale Kammer
für PerioMate-Pulver auf Glycin-Basis sind perfekt geeignet, um Biofilm zu entfernen. Varios
Combi Pro ist ein eigenständiges Gerät, das
externe Luft- und Wasseranschlüsse benötigt.
Es ist einfach zu bedienen und mit den ultraleichten Handstücken, der automatischen
Reinigungsfunktion und dem übersichtlichen
Display äußerst benutzerfreundlich. Flexible
Lösung gesucht? Das iCart, ein spezielles
Cart auf Rädern, bietet die Möglichkeit zum
schnellen Transport in der Praxis.
Erfahren Sie mehr über Varios Combi Pro
am Stand von NSK.
NSK’s Varios Combi Pro is the right choice
for comprehensive dental hygiene. The unit
combines two oral hygiene maintenance systems―an ultrasonic device and powder therapy
tools. The ultrasonic power is provided through
its iPiezo engine, delivers a stable frequency
output without dropping power, even on hard
calculus. In addition to a range of scaler tips,
the handpiece can be used with tips for various
other treatments, including perio tips, implant
maintenance tips, endodontic tips and a selection of restorative tips, making it an invaluable
multipurpose asset in the surgery.
For powder therapy, the Varios Combi Pro
has chambers, which easily connect and release
from the unit. A supragingival chamber for calcium carbonate-based Flash Pearl powder for
removing stains and a subgingival chamber for
glycine-based PerioMate powder are the perfect
solution for removing biofilm. The Varios Combi
Pro is a stand-alone device, requiring external
air and water connections. It is easy to use, with
its ultra-light weight powder therapy handpieces, auto-cleaning function and clear, easyto-use display. All this is wrapped up in a stylish
modern design. Looking for more portability?
The iCart, a specifically designed trolley on
wheels, is available to make it easier to switch
from surgery to surgery.
Come and experience 2-in-1 technology at
the NSK booth.
torations, such as IPS e.max ZirCAD, and
delivers highly aesthetic results.
Since its introduction in 2005, IPS e.max CAD
has revolutionised the dental market, and its legendary blue block has become the lithium disilicate material that dentists trust. IPS e.max CAD
restorations impress with their highly aesthetic
properties and a 97.2% survival rate over ten
years.4 The ten-year guarantee given on IPS e.max
restorations provides peace of mind.
A high flexural strength of 530 MPa and a
fracture toughness of 2.11 MPa m½ gives the
material its exceptional durability.5, 6 It covers a
wide range of applications, from thin veneers,
crowns, inlays, onlays and hybrid abutment
crowns7–9 through to three-unit bridges up to
the second premolar as the terminal abutment.
Restorations made of the high-strength CAD/
CAM chairside material can be cemented adhesively, self-adhesively or even conventionally.
Ivoclar offers products for every step of the
clinical workflow, starting with IvoSmile for
the initial consultation through to OptraGate
for relative isolation, IPS e.max CAD, the
Programat CS6 and cementation with Variolink
Esthetic. All the products are designed to perfectly meet the requirements of everyday clinical procedures.
Check out the IPS e.max product portfolio
and other innovations by visiting Ivoclar’s booth
at IDS 2023.
Ivoclar, Liechtenstein
www.ivoclar.com
Hall 11.3
Booth A010/C029
References
PARODONTOMETER NACH PROF. HÜSAMETTIN GÜNAY
PERIODONTOMETER ACCORDING TO PROF. HÜSAMETTIN GÜNAY
Seit mehr als 90 Jahren ist E. Hahnenkratt bekannt für qualitativ hochwertige
Instrumente, auschließlich hergestellt im
Baden-Würtembergischen Königsbach-Stein.
Neu im Sortiment ist ein Parodontometer,
der in Zusammenarbeit mit Prof. Hüsamettin
Günay (Medizinische Hochschule Hannover)
das bestehende Produktprogramm mit elf
Parodontometerspitzen ergänzt. Mit der
neuen Skalierung lassen sich alle Werte bestimmen, die für die Umsetzung der neuen
Richtlinie zur systematischen Behandlung
von Parodontitis und anderen Parodontalerkrankungen notwendig sind. Sie vereinfacht die Dokumentation und Diagnostik
parodontaler und periimplantärer Erkrankungen durch ein rasches Erkennen der
Parodontalen Screening Index-Werte 3,5
und 5,5 mm.
Vorteile des Parodontometers
Die tiefschwarze Diamond-like-CarbonBeschichtung sorgt für maximalen Kontrast
und optimierte Lesbarkeit. Außerdem erlauben die feine kugelförmige Spitze und die
fugenfreien Übergänge der Markierungen
im Messbereich einen atraumatischen Sondierungsvorgang.
For more than 90 years, E. Hahnenkratt has
been known for high-quality instruments that
are exclusively manufactured in KönigsbachStein in Germany. The company’s new periodontometer, which was developed in collaboration with Prof. Hüsamettin Günay (Hannover
Medical School, Germany) complement the existing product range with eleven periodontometer tips. With the new measurement scale, all
values necessary for the implementation of the
new treatment guidelines for periodontitis can
be determined. It simplifies the documentation
and diagnosis of periodontal and peri-implant
diseases by a quick reading of the periodontal
screening index values 3.5 and 5.5 mm.
Advantages of the periodontometer
The deep-black “diamond-like carbon” coating provides maximum contrast and optimised
readability. In addition, the fine spherical tip
and seamless transitions of the markings in the
measurement area allow an atraumatic probing process.
E. Hahnenkratt, Germany
www.hahnenkratt.com
NSK, Japan
www.nsk-dental.com
Hall 11.1, Booth A010/C019
40th International Dental Show 2023 • 14. März 14 March
QR-Code
[50] =>
untitled
industry
50
DAS 3SHAPE TRIOS INTRAORALSCANNER-PORTFOLIO 3SHAPE TRIOS INTRA-ORAL SCANNER PORTFOLIO
lichkeiten und Live-Veranstaltungen
der 3Shape Academy nutzen, um
Best Practices zu erlernen und Fortbildungspunkte zu erwerben.
TRIOS – Benutzerfreundlichkeit, Geschwindigkeit
und Genauigkeit
Die 3Shape TRIOS Intraoralscanner haben zehn Jahre in Folge den
renommierten Cellerant Best of
Class Technology Award erhalten.
Das TRIOS-Portfolio umfasst
TRIOS 5 Wireless, der für verbesserte Hygiene, beste Ergonomie sowie müheloses Scannen entwickelt
wurde; TRIOS 4 Wireless, der über
eine fortschrittliche kabellose Scantechnologie und diagnostische Behandlungsmöglichkeiten verfügt; und
TRIOS 3 Wired, dessen bewährte
Scantechnologie einen reibungslosen
Einstieg in die Digitale Zahnmedizin
bietet.
Für alle drei Modelle werden
kostenlos folgende Komponenten
mitgeliefert: 3Shape-Apps für die Patientenkommunikation, TRIOS Smile
Design, TRIOS Patient Monitoring,
TRIOS Treatment Simulator und
Model Maker. Darüber hinaus sind
alle drei Modelle kostenlos mit der
3Shape Unite-Plattform verbunden –
einem ständig wachsenden Ökosystem mit über 8.000 integrierten Laboren, Herstellern von Clear Alignern,
Anbietern von Implantatlösungen,
3D-Druckern und Fräsmaschinen,
Praxismanagement-Lösungen und
vielem mehr. Die 3Shape Unite-Plattform ermöglicht es Zahnärztinnen
und Zahnärzten, Behandlungsfälle
mühelos zu finden und an jeweilige
Partner zu senden sowie mit ihren
eigenen digitalen Dentallösungen zu
arbeiten.
Die TRIOS-Scanner sind für ihre
Benutzerfreundlichkeit, Scangeschwindigkeit und Genauigkeit bekannt. In
klinischen Studien und Erfahrungsberichten dokumentieren Zahnmedizinerinnen und Zahnmediziner den
Einsatz des TRIOS-Scanners für alle
Indikationen – von Einzelkronen
und Clear Alignern bis hin zu Implantatbehandlungen, Totalprothesen und dem Scannen von zahnlosen
Patienteninnen und Patienten.
In Studien hat TRIOS in Bezug auf
Genauigkeit, Präzision und Geschwindigkeit besser oder genauso gut abgeschnitten, wie die Scanner von Mitbewerbern. Und wie bei allen intraoralen
Scannern haben die Patientinnen
und Patienten in Vergleichsstudien
digitale TRIOS-Abdrücke vor konventionellen Abdrücken mit überwältigender Mehrheit bevorzugt.
Echte Freiheit einer
kabellosen Verbindung
Zahnärztinnen und Zahnärzte
können ihren TRIOS-Scanner mit
TRIOS Care unterstützen – einem
Rundum-sorglos-Servicevertrag, der
Software-Updates, unbegrenzten
Support, eine Fünf-Jahres-Vollgarantie, Ersatzgerät bei versehentlichem
Fallenlassen, Express-Ersatzgerät,
ein Onboarding-Programm und vieles mehr umfasst. Alternativ können
Zahnärztinnen und Zahnärzte
TRIOS Only wählen – einen kostenlosen Service, der Software-Updates
und den Support auf Bezahlungje-Anfrage-Basis umfasst.
Benutzerinnen und Benutzer
können auch Online-Schulungsmög-
Im Oktober 2022 präsentierte
3Shape TRIOS Share, die weltweit
erste Lösung, die es Zahnärztinnen
und Zahnärzten ermöglicht, mit einem einzigen kabellosen TRIOS-Intraoralscanner das Scannen und die
Behandlungsplanung von jedem PC
in Ihrer Praxis aus durchzuführen.
Über TRIOS Share werden die
kabellosen TRIOS-Scanner mit dem
WLAN-Netzwerk der Praxis verbunden. So können Zahnärztinnen und
Zahnärzte den TRIOS-Scanner einfach von einem zum anderen Raum
mitnehmen und einen beliebigen
PC im jeweiligen Behandlungsraum
zum Scannen und Planen verwenden. TRIOS Share kann sogar auf
Praxis-PCs verwendet werden, auf
denen zum Beispiel Patientenverwaltungssoftware läuft.
Diese Konfiguration erfordert
weder eine zusätzliche 3ShapeLizenz noch einen WLAN-Hub mit
einem klaren Signalpfad, da TRIOS
Share über Standard-WLAN funktioniert und nicht über das 60-GHzNetzwerk wie andere Scannermarken.
3Shape TRIOS intra-oral scanners
have received the prestigious Cellerant Best of Class Technology Award
for an unprecedented ten years in a
row!
The TRIOS intra-oral scanner
portfolio features TRIOS 5 Wireless,
which was designed for improved hygiene, next-level ergonomics and effortless scanning; TRIOS 4 Wireless,
which features advanced wireless
scan-ready technology and diagnostic
treatment options; and TRIOS 3
Wired, which offers proven scanning
technology for a smooth introduction
to digital dentistry.
All three models include free
3Shape patient engagement apps,
TRIOS Smile Design,TRIOS Patient
Monitoring, TRIOS Treatment Simulator and Model Maker. In addition, all
models can freely connect to the
3Shape Unite platform—an ever-expanding ecosystem of over 8,000 integrated laboratories, clear aligner
makers, implant solutions, 3D printers and milling machines, practice
management software solutions and
more. The 3Shape Unite platform
makes it seamless for dentists to find
and send cases to treatment partners
as well as work with their own digital
dentistry solutions.
Dental professionals can support
their scanning with TRIOS Care—a
complete peace-of-mind service agreement that includes software updates,
unlimited support coverage, a fiveyear full warranty, accidental drop
coverage, express replacement and
training programme. Alternatively,
dental professionals can select TRIOS
Only—a free service that includes
software updates and pay per case
coverage.
AMBER MILL DIRECT CAD-BLOCK ERMÖGLICHT CHAIRSIDE-RESTAURATIONEN IN 60 MINUTEN
AMBER MILL DIRECT CAD BLOCK DELIVERS CHAIRSIDE RESTORATIONS IN 60 MINUTES
HASSBIO, ein führender Hersteller
von keramischen Dentalmaterialien,
hat vor Kurzem Amber Mill Direct auf
den Markt gebracht, einen vorkristallisierten Lithiumdisilikat-Block, mit
dem Chairside-Restaurationen innerhalb einer Stunde geliefert werden
können. Die einzigartigen Eigenschaften von Amber Mill Direct ermöglichen es Zahnärztinnen und Zahnärzten, hervorragende ästhetische
Ergebnisse mit großer Opaleszenz und
Transluzenz zu erzielen, ohne dass
eine Ofenzeit erforderlich ist.
Yong-Su Kim, CEO von HASSBIO,
erklärt: „Amber Mill Direct verändert die Branche grundlegend, da
CAD/CAM-Zahnärztinnen und -Zahnärzte bereits seit vielen Jahrzehnten
nach einem Produkt suchen, mit
dem sie Restaurationen innerhalb
von 60 Minuten liefern und dabei
hervorragende Ergebnisse erzielen
können.“
Laut Dr. Yao-lin Tang vom Pacific Dental Center im kalifornischen
San Mateo in den USA „hat Amber
Mill Direct alle Vorteile von Lithiumdisilikat-Keramik. Die Stärken
des Produkts sind jedoch die schönen, glatten Ränder ohne Brennen –
ein unschätzbarer CAD-Block, den
jeder Zahnarzt in seiner Praxis haben sollte.“
HASSBIO, a leading manufacturer
of ceramic dental materials, recently
launched Amber Mill Direct, a
pre-crystalised lithium disilicate
block that achieves delivery of chairside restorations within 1 hour. The
unique properties of Amber Mill Direct allow practitioners to achieve
excellent aesthetic results that have
great opalescence and translucency
without the need for oven time.
Yong-Su Kim, CEO of HASSBIO,
stated that “Amber Mill Direct is an
industry game-changer because, for
many decades, CAD/CAM chairside
dentists have been asking for a
product that allows them to deliver
restorations within 60 minutes while
achieving excellent results”.
According to Dr Yao-lin Tang of
Pacific Dental Center in San Mateo
in California in the US, “Amber Mill
Direct has all the advantages of lithium disilicate ceramics. Its power,
however, is the beautiful smooth
margins without the need for firing—an invaluable CAD block that
every dentist should have in his or
her office.”
HASSBIO, South Korea
www.hassbio.com
Hall 11.2, Booth O041
40th International Dental Show 2023 • 14. März 14 March
3Shape Academy offers online
educational opportunities and live
events so that dental professionals
can learn best workflow practices and
earn continuing education credits.
TRIOS offers ease of use,
speed and accuracy
3Shape TRIOS intra-oral scanners are recognised for their ease of
use, scanning speed and accuracy. In
clinical and case studies, dental professionals document TRIOS use for
all indications. This includes single
crowns, clear aligners, implant treatment and dentures, even scanning
fully edentulous patients.
In studies, TRIOS has performed
better than or as well as competitor
scanners in terms of accuracy, precision and speed. Additionally, comparison studies have shown that patients
overwhelmingly prefer digital impressions being taken with TRIOS compared with conventional analogue
impressions.
True wireless freedom
In October 2022, 3Shape introduced TRIOS Share—the world’s first
solution that enables dental professionals to scan and plan on every PC
in their practice with a single TRIOS
wireless intra-oral scanner. TRIOS
Share connects TRIOS wireless scanners to the practice’s Wi-Fi network.
This allows dental professionals to
walk from room to room with TRIOS
in hand and use whatever PC is in the
respective surgery, including practice
management system PCs, to both
scan with and manage cases on.
Extra 3Shape licences are not
needed, nor are Wi-Fi hubs or clear
paths to the Wi-Fi network. TRIOS
Share runs on standard Wi-Fi, not
on point-to-point, 60 GHz connections
like other brands.
3Shape, Denmark
www.3shape.com
Hall 4.2
Booth J098/K099
[51] =>
untitled
3DISC reinvents
IOS usage in the clinic
The Scan&Tell communication-hub
One stop-solution
for 2D images,
3D impression,
tell, show and do
«The Scan&Tell is a digital revolution,
I use it in most appointments. I love my
new Communication Hub ! I am using
OVO as an IOS, an intra-oral camera and
to enhance my patient communication
and acceptance rate !”
Dr Lopes
[52] =>
untitled
industry
52
PRÄZISE 3D-DRUCKER FÜR EIN ZUVERLÄSSIGES KLINISCHES ERGEBNIS
PRECISE 3D PRINTERS FOR A PREDICTABLE CLINICAL OUTPUT
In Kombination mit einer Reihe
von Prozessüberwachungsfunktionen stellt die Smart Position SystemTechnologie von Asiga sicher, dass
jedes Objekt in einer kontrollierten
Umgebung hergestellt wird, was
Produktionssicherheit und Patientensicherheit gewährleistet. Die 4K-DLPBildauflösung und leistungsstarke
UV-LED-Optionen ermöglichen einen
superschnellen 3D-Druck in zeitkritischen Umgebungen.
Diese Produktionspräzision, -konsistenz und -geschwindigkeit, in
Kombination mit einem einfachen
Workflow, bietet eine fundierte Lö-
sung für die sichere Herstellung jedes zahnmedizinischen Produkts.
Asiga 3D-Drucker sind sowohl im
Dentallabor als auch in der Praxis
für eine zuverlässige Produktion von
Modellen mit herausnehmbaren
Stümpfen, Studienmodellen, Provisorien, Schablonen, Löffeln, Try-Ins,
Schienen, Zahnersatz oder Großserienmodellen für Aligner bekannt.
Erhalten Sie unbegrenzten und
uneingeschränkten Zugang zu mehr
als 500 branchenführenden Materialien mit Asigas Open Material Architecture für ultimative Materialflexibilität und -auswahl. Machen Sie
Ihren 3D-Druck mit Asiga zukunftssicher und bleiben Sie auf dem neuesten Stand bezüglich neuer Materialien. Wechseln Sie Materialien in
Sekundenschnelle, ohne dass eine
Kalibrierung erforderlich ist, um Ihren Arbeitsablauf zu optimieren.
Asigas Sortiment an austauschbaren Materialwannen bietet die
Möglichkeit, Teile mit einer hochglänzenden oder matten Oberfläche
zu drucken. Wechseln Sie einfach
die Materialwanne, um mit einer
hochglänzenden Oberfläche zu drucken oder wieder zurück, um mit
einer matten Oberfläche zu drucken.
Asigas Materialwannen-Optionen
bieten ein Oberflächenfinish direkt
aus dem 3D-Drucker, was Arbeitszeit und Kosten spart.
Das Asiga-Netzwerk von geschulten und autorisierten Händlern wird
durch Asigas unbegrenzten lebenslangen technischen Support über
das Online-Kundendienstzentrum
von Asiga unterstützt.
In combination with a suite of process monitoring features, Asiga’s
Smart Position System technology ensures that every device is produced
in a controlled environment providing
production assurance and patient
safety. The 4K DLP image definition
and high-powered UV LED options
allow for superfast 3D printing in
time-critical environments.
This production accuracy, consistency and speed combined with a
simple customer workflow provides a
grounded solution to confidently manufacture any dental appliance. Asiga’s
3D printers are well trusted in both
the dental laboratory and dental
clinic for the reliable production of
dental models with removable dies,
study models, temporary restorations, guides, trays, try-ins, splints,
dentures or high-volume models for
clear aligners.
Gain unlimited and unrestricted
access to more than 500 industryleading materials with Asiga’s open
material architecture for the ultimate
in material flexibility and choice.
Future-proof your 3D printing capabilities with Asiga and stay up to date
with the latest material releases.
Switch materials in seconds without
the need for calibration for workflow
optimisation.
Asiga’s range of interchangeable
resin trays provide an option to print
parts with either a high-gloss or
matte-surface finish. Simply switch
over the resin tray to print with a
high-gloss finish or back again to print
with a matte finish. Asiga’s resin tray
options provide an end-use finish
directly from the 3D printer saving
labour time and cost.
The Asiga network of trained and
authorised resellers is backed up by
Asiga’s unlimited lifetime technical
support via the Asiga online customer
service centre.
Asiga, Australia
www.asiga.com
Hall 3.1, Booth H030
ADMIRA FUSION 5 VON VOCO – VEREINFACHTES FARBSYSTEM DURCH CLUSTER-SHADES
ADMIRA FUSION 5 BY VOCO—SIMPLIFIED SHADE SYSTEM THROUGH CLUSTER-SHADES
Die richtige Bestimmung der
Zahnfarbe ist das A und O für ein
ästhetisches Ergebnis einer Restauration. Hier stets die optimale Farbe
zu finden, ist oft gar nicht so leicht.
VOCO hat es sich daher zum Ziel gesetzt, Zahnärztinnen und Zahnärzten ein hochmodernes UniversalFüllungsmaterial anzubieten, das
den Praxisalltag extrem vereinfacht. Die Lösung ist die Weiterentwicklung des innovativen, rein
keramisch basierten ORMOCER
Füllungsmaterials Admira Fusion.
Mit dem neuen Universal-Komposit
Admira Fusion 5 ist es ab sofort
möglich, alle VITA classical Farben
mit nur fünf Cluster-Shades abzudecken.
Neue und patentierte
Harzmatrix
Admira Fusion 5 verwendet fünf
verschiedene Cluster-Shades, die jeweils mehrere VITA-Farben bündeln.
Dieses Cluster-Shade-System wird
durch die neue patentierte Harzmatrix ermöglicht. Diese wurde auf die
Größe und optischen Eigenschaften
der Nanohybrid-Partikel angepasst,
wodurch eine optimierte Lichtstreuung erreicht wird. Das Resultat ist
ein gezielter und verstärkter Chamäleon-Effekt innerhalb der jeweiligen
Cluster-Shade, der die perfekte Anpassung des Füllungsmaterials an
die natürliche Zahnfarbe ermöglicht.
Dank dieses vereinfachten Farbsystems sind Zahnarztpraxen mit nur
fünf Farben für alle Fälle in ihrem
Praxisalltag optimal aufgestellt.
Durch die Optimierung der Harzmatrix ist es zudem gelungen, die Poly-
merisationszeit deutlich zu reduzieren. Für alle fünf Farben ist eine
Lichthärtung von nur 10 Sekunden
notwendig.
Bewährte ORMOCERTechnologie
Sowohl die Füllstoffe als auch
die Harzmatrix beruhen bei Admira
Fusion 5 auf Siliziumoxid. Dies
bringt gleich mehrere Vorteile mit
sich: Ein rein keramisch basiertes
Material ohne klassische Monomere
sowie exzellente physikalische Eigenschaften. So weist das Produkt
beispielsweise die mit Abstand niedrigste Polymerisationsschrumpfung
(1,25 Vol.-%) im Vergleich zu herkömmlichen Kompositen auf. Admira
Fusion 5 ist mit allen konventionellen Bondings kompatibel und ist sowohl in Spritzen als auch in Caps erhältlich.
posite Admira Fusion 5, it is now possible to cover all VITA classical
shades with just five Cluster-Shades.
New and patented resin
matrix
Admira Fusion 5 uses five different Cluster-Shades, each of which bundles several VITA classical shades.
This Cluster-Shade-System is made
possible by the new patented resin matrix, which has been adapted to the size
and optical properties of the nano-hybrid particles, resulting in optimised
light scattering. The result is a targeted
and enhanced chameleon effect within
the respective Cluster-Shade, which allows the filling material to perfectly
match the natural tooth shade. Thanks
to this simplified shade system, dental
practices are optimally positioned for
all cases in their daily practice with
only five shades and can thus significantly slim down their inventory. There
is no need for multi-colour layering or
the use of an additional blocker or
opaquer. By optimising the resin matrix, it has also been possible to significantly reduce the light-curing time.
For all five shades, a polymerisation of
The correct determination of the
tooth shade is the key for an aesthetic
result of a restoration. Finding the optimal shade is often not that easy. One
of the most common methods to define the tooth shade is the use of
shade guides. Compared to the variety of shades that a natural tooth has,
a shade guide can only show a limited
colour spectrum, which can lead to
an incorrect shade selection. Therefore, VOCO has set itself the goal of
offering dentists a state-of-the-art universal filling material that extremely
simplifies daily practice. The solution
is the further development of the
innovative, purely ceramic-based
ORMOCER filling material Admira
Fusion. With the new universal com-
40th International Dental Show 2023 • 14. März 14 March
only 10 seconds is necessary. This
saves valuable time.
Proven ORMOCER technology
With Admira Fusion 5, dentists
benefit from the advantages of the
proven technology of the high-performance composite Admira Fusion.
The innovative combination of nanohybrid and ORMOCER (organically
modified ceramics) technology, in
which both fillers and resin matrix
are based on silicon oxide, enables a
purely ceramic-based material. Due
to the ORMOCERs used, Admira Fusion 5 is highly biocompatible, as it
does not contain any classic monomers. In addition, the material has
by far the lowest polymerisation
shrinkage of 1.25% by volume compared with all conventional restorative composites.
VOCO, Germany
www.voco.dental
Hall 5.2, Booth C040
Hall 10.2, Booth N010/
O019, N020/O029
[53] =>
untitled
HYDROSONIC
PRO
GENIAL
SANFT,
HÖCHST
WIRKSAM
MADE IN SWITZERLAND
BESUCHEN SIE UNS
AUF UNSEREM STAND
AUF DER IDS
HALLE 05.2.
STAND D-051
SWISS PREMIUM ORAL CARE
[54] =>
untitled
industry
54
HEYGEARS ERWEITERT ANGEBOT AN AUTOMATISIERTEN UND INTELLIGENTEN PRODUKTIONSLÖSUNGEN FÜR DENTALLABORE
HEYGEARS EXPANDS AUTOMATED AND INTELLIGENT PRODUCTION SOLUTIONS FOR DENTAL LABORATORIES
HeyGears hat vor Kurzem den neuen 3DDrucker UltraCraft A3d, für Dentallabore mit
großem Bedarf an 3D-Druck, auf den Markt gebracht. Der UltraCraft A3D verfügt über eine
intelligente Steuerung und vollständig automatisierte Produktionsfunktionen, wie dem
automatischen Abtrennen von Druckteilen
und einem Sammelbehälter für Druckteile. Damit kann er mit minimaler Überwachung betrieben werden und erfordert weniger manuelle Eingriffe. Die UltraCraft Resin Station ist
ein Anbauteil, das bis zu vier A3D-Drucker automatisch mit Dentalharz befüllen kann und
so einen ununterbrochenen automatisierten
Druckprozess rund um die Uhr ermöglicht.
Eine Resin Station fasst bis zu vier 6-LiterFlaschen mit Harz und befüllt jeden A3D individuell. Jede Flasche kann ein anderes Harz
enthalten, um so die Flexibilität in der Produktion zu erhöhen. Durch die Verwendung mehrerer A3Ds mit der Resin Station können
große Dentallabore einfach ihre Produktion
erweitern und mehr Aufträge abarbeiten.
Eine weitere Ergänzung für Dentallabore
ist die UltraCraft Wash Station, die bald verfügbar sein wird. Diese Maschine kann große Mengen im 3D-Druck hergestellter Dentalvorrichtungen reinigen. Die Wash Station ist in der
Lage, 200 Clear Aligner-Modelle in einer Stunde
zu reinigen. Durch den automatisierten sauberen und schnellen Prozess wird der erforderliche manuelle Aufwand drastisch reduziert. In
Verbindung mit dem UltraCraft A3D und der
Resin Station erhalten Dentallabore so eine effiziente und automatisierte Produktionslösung
in großem Maßstab für ihren Bedarf an 3DDruck.
HeyGears arbeitet eng mit Dentallaboren
auf der ganzen Welt zusammen, um Ausrüstung
und Lösungen für den 3D-Druck zu entwickeln,
die optimal auf ihre Bedürfnisse abgestimmt
sind. Dazu bietet HeyGears außerdem mit seinem erfahrenen Team von Dentalentwicklern
Services für die Dentalmodellierung sowie mit
den HeyGears Cloud-Services automatisierte und
intelligente Funktionen für die Vorverarbeitung
und die Druckverwaltung.
HeyGears ist ein innovationsgetriebenes
Unternehmen, das digitale Fertigungslösungen
bereitstellt und Kernkompetenzen in Technologie, Materialien und Softwareentwicklung für
den 3D-Druck bietet. Durch diese Kombination
bietet HeyGears umfassende Lösungen, von den
gescannten Daten bis hin zum 3D-Druck, die
einfach, schnell und genau angewendet werden können.
Weitere Informationen über die Lösungen
von HeyGears für Dentallabore, darunter der
UltraCraft A3D, die Resin Station und die demnächst verfügbare Wash Station, erhalten Sie
am Stand von HeyGears auf der IDS.
A new, upcoming addition for dental lab production is the UltraCraft Wash Station. This automated machine is designed to wash large
quantities of 3D-printed dental applications. The
Wash Station is capable of washing 200 clear
aligner models within an hour. Its automated fast
processes greatly reduce the amount of manual
interaction required. When used in conjunction
with the UltraCraft A3D and Resin Station, dental
labs will have an efficient, large-scale, automated
production solution for their 3D-printing needs.
By providing dental design services via its
experienced Dental Design Team, as well as automated intelligent pre-processing and print
management capabilities via its HeyGears Cloud
services, HeyGears is able to work closely with
dental labs worldwide to develop the best tailored 3D-printing equipment and solutions.
HeyGears is an innovation-driven company
devoted to providing digital manufacturing solutions and bases its core competencies on 3Dprinting technology, materials and software development. By combining these focuses, HeyGears
provides complete, comprehensive solutions from
scanned data to 3D printing that are easy, fast
and accurate.
For more information about HeyGears dental lab solutions, including the UltraCraft A3D,
Resin Station, and upcoming Wash Station, visit
the HeyGears booth at IDS.
HeyGears, USA
www.heygears.com
Hall 10.1
Booth C088/D089
HeyGears recently released its new UltraCraft A3D 3D printer for dental laboratories with
large-scale 3D-printing needs. The UltraCraft
A3D has smart controls and fully automated
production features such as auto-printed part
removal, and a printed part collection bin which
allows it to function with minimal oversight and
reduce manual operations. The UltraCraft Resin
Station is an attachment that can provide automatic dental resin refill for up to four A3D printers and create a 24/7 non-stop automated printing process. One Resin Station can hold up to
four 6-litre bottles of resin and refill each A3D
individually. Each bottle can contain a different
resin to provide greater production flexibility.
Using multiple A3Ds with the Resin Station allows large dental labs to easily scale up their
production and fulfill more orders.
CLEARCORRECT: IHR PARTNER IN DER KIEFERORTHOPÄDIE
ClearCorrect, die führende kieferorthopädische Marke der Straumann
Group, freut sich, neue Produkte und
Funktionen anzukündigen, die aktuell zum ersten Mal auf der IDS zu sehen sind. Diese Neuerungen unterstützen Zahnärztinnen und Zahnärzte
bei der Behandlung komplexerer
Fälle mit neuen klinischen Funktionen, einem verbesserten digitalen
Workflow sowie zusätzlichen Supportund Planungsdiensten.
Die Markteinführung umfasst
auch Verbesserungen an ClearCorrects
Aligner. Der ClearCorrect-Aligner ist
das Ergebnis jahrzehntelanger Materialwissenschaft, Forschung und
Innovation und kombiniert das proprietäre ClearQuartz-Material, eine
hohe und flache Trimline sowie wissenschaftlich erprobte klinische
Funktionen.
Zu den Verbesserungen des Aligners gehört ein verbesserter durchgängiger Arbeitsablauf, der es Behandlerinnen und Behandlern ermöglicht,
Patientinnen und Patienten mit fehlenden oder durchbrechenden Zähnen mit Brückengliedern und Schablonen zu behandeln. Zu diesen neuen
klinischen Funktionen gehören optimierte Formen für ein ästhetisches
Aussehen, die bequeme Größenanpassung von Elementen im Verlauf der
Behandlung und die Flexibilität bei
der Implementierung in jedem Behandlungsschritt.
ClearCorrect bringt auch eine
Reihe von Verbesserungen für den digitalen Workflow auf den Markt: ein
leistungsstarkes digitales Ökosystem gibt Anwenderinnen und Anwendern die Kontrolle über ihre Behandlungen und maximiert gleichzeitig die Produktivität. Mit intuitiven
Arbeitsabläufen und fortschrittlichen klinischen Planungstools war
es noch nie so einfach, optimale Behandlungspläne zu erstellen.
Der aktualisierte digitale Workflow umfasst ein dynamisches Verschreibungsformular, das Behandle-
rinnen und Behandler zu optimalen
Behandlungsprotokollen führt und
gleichzeitig erweiterte Anpassungsoptionen bietet. Zu den Funktionen
gehören neue Behandlungsansätze,
ein aktualisierter Datensatz-Uploader
und ein geführtes Verschreibungsformular mit dynamisch angezeigten Optionen.
Zusammen mit dem neuen Verschreibungsformular wird ClearCorrect
die ClearCorrect Sync-App auf den
Markt bringen, die es den Behandlerinnen und Behandlern ermöglicht,
schnell neue Fälle anzulegen, hochwertige Fotos mithilfe von geführten
Vorlagen aufzunehmen, Fotos mit intuitiven Werkzeugen zu bearbeiten
und Patientendaten und Fotos direkt
in das Anwenderportal hochzuladen.
Für die Einreichung intraoraler
Scans wurden Verbesserungen vorgenommen, um die Integrationen mit Intraoralscannern zu optimieren. Neue
Updates der Virtuo Vivo-Software ermöglichen einen deutlich schnelleren Scan für ClearCorrect, was die
Effizienz des gesamten Workflows erhöht. Die Aktualisierungen der 3Shape
Unite-Integration umfassen eingebettete Arbeitsabläufe für die Einreichung von Retainern und Revisionen
sowie einen direkten Zugriff auf
ClearPilot.
Zur Unterstützung und Hilfe bei
der Behandlungsplanung wird ClearCorrect Collaborator 4.0 eingeführt,
eine Integration, die es Behandlerinnen und Behandlern ermöglicht,
Behandlungsplanungsdienste (TPS)
direkt bei den globalen TPS-Partnern
von ClearCorrect zu bestellen. Dieser Workflow ermöglicht es, mit zusätzlicher Unterstützung bei der
Behandlungsplanung optimale Behandlungs-Set-ups zu erzielen.
Die neueste Aktualisierung des
digitalen Workflows umfasst die Einführung von ClearPilot 6.0. Diese Version bietet eine Reihe von Upgrades,
die Kundinnen und Kunden eine intuitivere und benutzerfreundlichere Behandlungsplanung ermöglichen. Zu
den aktualisierten Funktionen gehören die direkte Bearbeitung von Kollisionen und Abständen mit automatischer Anpassung der Nachbarzähne
sowie Punkt-zu-Punkt-Messwerkzeuge.
Das Highlight der neuen Version ist
eine verbesserte Benutzeroberfläche,
einschließlich verbesserter 3D-ModellRenderings, eines optimierten Viewers
und einer aktualisierten Behandlungszeitleiste.
All diese Veröffentlichungen werden durch Service und Support von
ClearCorrect komplettiert. Durch die
Kombination von klinischem Fachwissen mit dem Engagement für
Fortbildung und hervorragendem
Support bietet ClearCorrect Zahnärztinnen und Zahnärzten eine Partnerschaft in der Kieferorthopädie, die ihnen hilft, das Potenzial ihrer Praxis zu
erschließen.
ClearCorrect unterstützt diese
Partnerschaft und ist stolz darauf, auf
der IDS den Ortho Campus vorzustel-
40th International Dental Show 2023 • 14. März 14 March
len, eine umfassende Sammlung kieferorthopädischer Werkzeuge und
Lehrpläne für den ClearCorrect Behandlungserfolg. Ganz gleich, ob Kliniker ihr klinisches Selbstvertrauen
stärken oder eine florierende digitale
kieferorthopädische Praxis aufbauen
wollen, Ortho Campus bietet ihnen
die dafür notwendigen Lehrmittel.
Unterstützt wird diese Partnerschaft durch Ortho Campus, eine
umfassende Sammlung kieferorthopädischer Werkzeuge und Lehrpläne
für den Behandlungserfolg. Unabhängig davon, ob Zahnärztinnen und
Zahnärzte ihr klinisches Selbstvertrauen stärken oder eine florierende
digitale kieferorthopädische Praxis
aufbauen möchten, Ortho Campus
stellt ihnen die Fortbildungsinstrumente zur Verfügung, die sie benötigen, um dies zu erreichen. ClearCorrect
führt den Ortho Campus offiziell auf
der IDS ein.
Erfahren Sie mehr über ClearCorrect am Straumann-Stand und
werden Sie Partner.
For English readers, check out tomorrow’s issue of today. Stop by the
Straumann booth and get your copy!
ClearCorrect
(Straumann Group
brand), Switzerland
www.straumann.com/clearcorrect/en/doctors
Hall 4.2
Booth G080/J089
[55] =>
untitled
IDS 2023
AUF BEGO KÖNNEN SIE ZÄHLEN
über
560 1100
80 360
400 11.500
m2
über
STANDFLÄCHE
KOMPETENTE GESPRÄCHSPARTNER
FÜR SIE TÄGLICH
FACHVORTRÄGE
LIVE DEMONSTRATIONEN
über
über
über
YOUTH-BOAT-BUCHUNGEN
DES DENTALEN NACHWUCHSES
GEDRUCKTE KRONEN
FÜR SMART VENEERING
Überzeugen Sie sich selbst auf der IDS 2023
Halle 10.2 Stand M-010 / N-019
www.bego.com
Miteinander zum Erfolg
[56] =>
untitled
industry
56
NAVIDENT EVO: ERWEITERUNG DES DIGITALEN WORKFLOWS ERMÖGLICHT CHIRURGISCHE EINGRIFFE
NAVIDENT EVO: EXTENSION OF DIGITAL WORKFLOW ALLOWS FOR SAME-DAY GUIDED SURGERY
Sind Sie ständig auf der Suche nach Möglichkeiten, Ihre Praxis von anderen abzuheben? Wir kennen die Herausforderungen, denen
Sie begegnen, wenn Sie höchste Leistungen
und Ergebnisse anstreben – organisatorisch,
funktionell und ästhetisch.
Denken Sie an einen Workflow für Diagnostik, Implantatplanung und dynamische
Navigationsbehandlungen von Implantaten. Behandlerinnen und Behandler können durch die
dreidimensionale Kontrolle ihrer Implantataufbereitung und die dynamische Überwachung der Implantatinsertion hohe Präzision
und kürzere Eingriffe erreichen. Die Prozedur dauert nur wenige Minuten, vom CBCT-Scan
bis zum Beginn der Operation. Navident bietet
eine verzögerungsfreie Führung des Bohrers
und der Implantatposition im Bezug zur Patientenanatomie auf der Grundlage des CBCTScans in Echtzeit.
Navident EVO bietet vorhersehbare
Ergebnisse in verschiedenen
Fachbereichen
Implantologie: Mit Navident EVO können
Sie hochpräzise Implantatbehandlungen schnell
und zuverlässig durchführen. Es hilft, wichtige anatomische Strukturen präzise zu erkennen.
Endodontie: Navident EVO hilft bei der
einfachen Lokalisierung von Wurzelkanälen
und anderen empfindlichen anatomischen
Strukturen.
Knochenchirurgie: Mit der hohen Präzision der Navigation Ihres Piezotoms oder Ihrer
Säge ermöglicht Navident EVO eine genaue
Beurteilung und vorhersehbare Ergebnisse in
Knochenchirurgie-Verfahren.
Das neue Navident EVO-System ist mit
neuester Kameratechnologie, einschließlich robotergestütztem Tag Tracking, ausgestattet. Außerdem bietet es auch ein elegantes Design, eine
ergonomische Installation, eine intuitive Benutzer-
oberfläche als auch Touchscreen-Interaktion,
und ist so konzipiert, dass es einen angenehmen, reibungslosen Workflow für Behandlerinnen und Behandler jeder Karrierestufe bietet.
Verfügbare Konfigurationen für Navident
können sowohl auf einem Wagen, an der Wand,
Decke oder dem Behandlungsstuhl befestigt
werden.
Navident erweitert seinen Markt rasch. Wir
sind auf der Suche nach Partnern, um gemeinsam voranzukommen. Unser Navigationssystem verfügt über internationale Zertifizierungen. Unser Unternehmen bietet einen
effizienten Support und Kundendienst in
mehreren Sprachen. Wir laden Sie ein, mit uns
zu wachsen. Treffen Sie uns auf der IDS in
Köln.
Are you constantly looking for ways to elevate
and differentiate your practice from others? We
know the challenges you face when you are aiming for the highest levels of performance and
results―organisational, functional
and aesthetic.
Think about a workflow for diagnostics, implant planning and
dynamically navigated implant treatments. Clinicians
can achieve high precision,
shorter interventions with
three-dimensional control of their implant
site preparation and dynamically monitored
implant insertion. The procedure only takes minutes from CBCT scanning to the start of the surgery. Navident provides real-time, lag-free guidance of the drill and implant position in relation
to patient anatomy based on the CBCT scan.
Endodontics: Navident
EVO helps in locating root
canals and other delicate anatomical structures with ease.
Bone surgery: With high-precision navigation of your piezotome or saw, Navident EVO allows for accurate assessment and predictable
outcomes in bone surgery procedures.
In addition to being equipped with a
next-generation camera technology including
robotic tag tracking, the new Navident EVO
system provides everything from sleek design
to ergonomic installation, intuitive user interface to touch screen interaction, and is created
to provide a pleasant, smooth workflow for
clinicians at every stage of their career.
Available configurations for Navident
are either cart-based, wall-, ceiling- or chairmounted.
Navident is expanding its market rapidly.
We are looking for partners to head forward together. Our navigation system has international
certifications, and our company offers efficient
support and customer service in multiple languages. We invite you to grow with us. Meet us
at IDS in Cologne.
Navident EVO offers predictable
results in various specialties
Implantology: With Navident EVO, you can
carry out high-precision implant treatments
with speed and confidence. It helps to detect important anatomical structures accurately.
ClaroNav, Canada
www.navident.claronav.com
Hall 10.2, Booth O053
REDON VEREINT TECHNOLOGIE, ENGINEERING UND ERFAHRUNG REDON COMBINES TECHNOLOGY, ENGINEERING AND EXPERIENCE
Redon Technology ist einer der führenden
Hersteller in der Dentalbranche und bietet innovative Lösungen für besseren, zuverlässigen
und schnelleren Service.
Als Redon Technology streben wir danach,
das Beste in der Dentalbranche anzubieten.
Unser Ansatz kombiniert Forschung und Entwicklung, Produktion, Vertrieb und Service,
um unseren Kunden und Partnern innovative
Lösungen anzubieten. Wir entwerfen und erstellen Produkte, die den Dentalbereich heute
und in Zukunft verbessern. Unser Engagement
für Innovation und Optimierung ermöglicht es
uns, unsere Produkt- und Serviceangebote
ständig zu verbessern.
Als Hersteller von Hightech-Produkten
verstehen wir die Bedeutung von Zuverlässigkeit und Produktivität. Deshalb stellen wir
sicher, dass unsere dentalen CAD/CAM-Fräsmaschinen nach hohen Qualitätsstandards
hergestellt werden und unser Ziel ist es, mit
unseren Produkten stets die Zufriedenheit unserer Kunden zu erreichen.
Wir sind einer der führenden Anbieter in
der dentalen CAD/CAM-Fräsmaschinenindustrie geworden, insbesondere in Europa und den
USA. Wir sind stolz darauf, dass unser Design
und unser ästhetischer Anspruch im Dentalbereich mit dem iF DESIGN AWARD und dem
German Design Award ausgezeichnet wurden.
Wenn Sie Interesse an einem neuen CAD/
CAM-System haben, sollten Sie sich aus folgenden Gründen für uns entscheiden: Wir sprechen
die gleiche Sprache wie Sie, verstehen Ihre
Anforderungen und gehen im Detail auf Ihre
Bedürfnisse ein. Wir stellen sicher, dass unsere
Produkte und Dienstleistungen von höchster
Qualität sind. Wir bieten unseren Kunden je
nach Bedarf spezialisierte Beratung, professionelle Unterstützung und Ersatzteilservice
und sind bestrebt, unseren Kunden einen
Wettbewerbsvorteil zu verschaffen, indem wir
innovative Produkte und Dienstleistungen anbieten, die durch Forschung und Entwicklung
im Einklang mit Markttrends und aktuellen
Anforderungen entwickelt werden.
Vertrauen Sie auf unsere Erfahrung und
unser Wissen in der Dentalbranche und besuchen Sie uns auf der IDS.
Redon Technology is one of the leading manufacturers in the dental industry, providing innovative solutions for better, more reliable and
faster service.
As Redon Technology, we strive to provide
the best in the dental industry. Our approach
combines research and development, production,
sales and service to bring innovative solutions
to our customers and partners. We design and
create products that enhance the dental field, both
today and for the future. Our dedication to innovation and optimisation allows us to constantly
improve our product and service offerings.
As a manufacturer of high-tech products,
we understand the importance of reliability and
productivity. That is why we ensure our dental
CAD/CAM milling machines are manufactured
Redon Best Mill.
40th International Dental Show 2023 • 14. März 14 March
to high-quality standards, and our goal is to
always achieve customer satisfaction with our
products.
We have become the preferred choice in the
dental CAD/CAM milling machine industry, especially in Europe and in the US, and we are
proud to have received recognition for our design and aesthetic excellence in the dental field
through the iF DESIGN AWARD and the German Design Award.
When considering your options, here is why
Redon Technology should be at the top of your
list. We are able to connect with our customers
on a deeper level, as we speak their language
and understand their needs. We ensure that our
products and services are of the highest quality. We offer specialised consulting, support and
spare parts services to our customers as needed
and strive to offer our customers a competitive
edge by providing innovative products and services that are developed through research and
development, all in line with market trends and
current demands.
Trust our experience and knowledge of the
dental industry and visit us at IDS.
Redon Technology,
Turkey
www.redon.com
Hall 1.2
Booth C020/D021
[57] =>
untitled
[58] =>
untitled
industry
58
ZWEI WELTMARKTFÜHRER KOOPERIEREN: KAVO UND MELAG BESCHLIESSEN VERTRIEBLICHE PARTNERSCHAFT
TWO WORLD MARKET LEADERS COOPERATE: KAVO AND MELAG AGREE ON SALES PARTNERSHIP
KaVo Dental und MELAG Medizintechnik haben zu Beginn des
Jahres 2023 eine engere Zusammenarbeit vereinbart. Mit ihrer Kooperation bilden KaVo und MELAG ein
neues Excellence-Team, das mit aufeinander abgestimmten Produktund Dienstleistungsangeboten die
Zukunft in der Instrumentenaufbereitung zusätzlich vorantreibt, um
die tägliche Arbeit in der Zahnarztpraxis kontinuierlich sicherer, zuverlässiger und effektiver zu gestalten. Im Fokus der engeren ver trieblichen Zusammenarbeit stehen
unter anderem gemeinsame Trainings für Fachhandelspartner sowie abgestimmte Marketing- und
Vertriebsaktionen. Auch gemeinsame Veranstaltungen für Endkunden sind weltweit geplant. Zudem ist
zukünftig eine stärkere gegenseitige Unterstützung im Bereich der
Forschung- und Entwicklung angedacht.
KaVo Dental bietet unter dem
Slogan „Dental Excellence“ seit über
100 Jahren dentale Kompetenz und
ein nahezu komplettes Premium-Produktportfolio für die zahnmedizinische Praxis und für Zahnlabore an.
KaVo ist seit über einem Jahrhundert
Garant für herausragende PremiumProdukte und mit einer Vielzahl von
Patenten und Gebrauchsmustern ein
weltweit führendender Anbieter im
dentalen Instrumentensegment.
Als eigentümergeführtes Familienunternehmen hat sich MELAG mit
Qualität und Innovationskraft als
ein Weltmarktführer in der Praxishygiene etabliert. MELAG entwickelt
und produziert seit der Firmengründung vor über 70 Jahren innovative
und technologisch robuste Lösungen
für die Instrumentenaufbereitung
ausschließlich in Berlin in Deutschland. Mit ihren herausragenden
Systemlösungen, unter anderem bestehend aus Autoklaven, Thermodesinfektoren und Siegelgeräten
konnte MELAG die Instrumentenauf-
Vorne/front (von links/from left): Armin Imhof (KaVo), Christoph Sandow (MELAG), Sebastian Gebauer (MELAG). Hinten/back (von links/from
left): Ferdinand Schmidt (MELAG), Jan Moed (KaVo), Dr Niklas Gebauer (MELAG), Christian Wiech (KaVo).
bereitung fortlaufend weiterentwickeln und maßgeblich prägen.
So ist es nicht verwunderlich,
dass KaVo für die Aufbereitung der
eigenen Premium-Instrumente explizit Produkte aus dem Hause MELAG
empfiehlt.
„Der hohe Anspruch an die eigenen Produkte und die Werte eines innovativen Traditionsunternehmens
machen MELAG für KaVo zum perfekten Partner in der dentalen Instrumentenaufbereitung. Als zuverlässige 4-in-1-Lösung harmoniert der
Careclave von MELAG perfekt mit
unseren hochwertigen KaVo-Instrumenten und ist daher auch unsere
klare Empfehlung zur Aufbereitung
unserer KaVo-Instrumente“, sagt
Armin Imhof, Chief Technical Officer
bei KaVo.
Dr. Niklas Gebauer, geschäftsführender Gesellschafter von MELAG
betont ergänzend: „KaVo-Hand- und
Winkelstücke waren für uns immer
die Benchmark, nicht nur in Bezug
auf Qualität und überdurchschnittlicher Haltbarkeit. Nicht umsonst haben wir bei der Entwicklung des
Careclave immer wieder intensiv auch
mit KaVo-Instrumenten getestet.“
Auf der IDS wird die Kooperation dann auch für die breite Öffentlichkeit sichtbarer. Der MELAG
Careclave wird auch auf dem Stand
von KaVo zu finden sein, und auf dem
MELAG-Stand werden die Careclaves
mit hochwertigen KaVo-Instrumenten bestückt sein.
KaVo Dental and MELAG have
agreed on closer cooperation from
the beginning of 2023. With this cooperation, KaVo and MELAG are
forming a new team of excellence
that is planned to drive the future of
instrument reprocessing with coordinated product and service offerings
in order to continuously make daily
work in dental practices safer, more
reliable and more effective. The focus
of the closer sales cooperation is joint
training for specialised trade partners as well as coordinated marketing and sales campaigns. Joint events
for end customers are also planned
worldwide. Stronger mutual support
is also planned in research and development in the future.
Under the slogan “Dental Excellence”, KaVo Dental has been offering
dental expertise and an almost complete premium product portfolio for
dental practices and dental laboratories for over 100 years. KaVo has
been a guarantor of outstanding premium products for more than a century and is one of the world’s leading
suppliers in the dental instrument
segment with a large number of patents and utility models.
As an owner-managed family
business, MELAG has established itself as a global market leader in offering quality and innovative strength in
dental hygiene. Since the foundation
of the company over 70 years ago,
MELAG has been developing and pro-
ducing innovative and technologically robust solutions for instrument
reprocessing, exclusively in Berlin in
Germany. With its outstanding system solutions, including autoclaves,
washer disinfectors and sealing devices, MELAG has been able to continuously develop and significantly
shape instrument reprocessing.
It is therefore not surprising that
KaVo explicitly recommends products from MELAG for the reprocessing of its own premium instruments.
“The high standards of our own
products and the values of an innovative, traditional company make
MELAG the perfect partner for KaVo
in dental instrument reprocessing.
As a reliable four-in-one solution, the
Careclave from MELAG harmonises
perfectly with our high-quality KaVo
instruments and is therefore also our
clear recommendation for reprocessing our KaVo instruments,” said
Armin Imhof, chief technical officer
at KaVo.
Dr Niklas Gebauer, a managing
partner of MELAG, added: “KaVo
straight and contra-angle handpieces
have always been the benchmark for
us, not only in terms of quality and
above-average durability. Therefore,
we have also tested intensively with
KaVo instruments during the development of the Careclave.”
At IDS, the cooperation will be
visible to the general public: the
MELAG Careclave will not only be
featured on the MELAG booth but
also on that of KaVo, and on the
MELAG booth, the Careclaves will
be equipped with high-quality KaVo
instruments.
KaVo Dental, Germany
www.kavo.com
Hall 1.2
Booth A010/C019
GC PRÄSENTIERT NEUEN AADVA IOS 200 MIT EINZIGARTIGER 4DR-TECHNOLOGIE
GC INTRODUCES NEW AADVA IOS 200 WITH UNIQUE 4DR TECHNOLOGY
Getreu dem Motto „Das Beste aus
beiden Welten“ setzt GC mit der Einführung des Aadva IOS 200 mit seiner
einzigartigen innovativen vierdimensionalen Regressions-Technologie
(4DR) neue Maßstäbe im Bereich des
digitalen Workflows.
Mit 4DR führt GC eine neue
Technologie für Intraoralscanner ein.
Eine zuverlässige und robuste Methode
zur Berechnung dreidimensionaler
Bilddaten ist eine Schlüsselvoraussetzung für jeden Intraoralscanner.
Der Aadva IOS 200 verwendet dabei
eine völlig neue Stereo-MatchingTechnologie, die speziell für die klinische Zahnheilkunde entwickelt wurde.
Sie überträgt die Berechnung der dreidimensionalen Formen in einen vierdimensionalen Raum und überwindet so bisherige Herausforderungen
bei der digitalen Abformung, wie Reflexionen, Speichel und Transluzenz.
Aadva IOS 200 nutzt die Stereotechnologie zur 3D-Messung, wodurch
das Scannerhandstück wesentlich
schlanker, kleiner und leichter
(ca. 120 g) wird. Dies bedeutet mehr
Benutzerfreundlichkeit für Zahnärztinnen und Zahnärzte, mehr Komfort
für Patientinnen und Patienten und einen leichteren Zugang zur Mundhöhle
bei Kindern sowie Patientinnen und
Patienten mit eingeschränkter Mundöffnung und natürlich zum schwer zugänglichen distalen Molarenbereich.
Die Spitze (ca. 30 g) des Scanners ist
autoklavierbar. Das trägt zur Vermeidung von Kreuzinfektionen bei.
Alle Dentalfachleute sind eingeladen, die Vorteile der Arbeitsabläufe
und Lösungen von GC in Hands-onKursen und bei Labordemonstrationen direkt zu erleben – auf der IDS am
Messestand. Dort werden auch täglich international renommierte Zahnärzte und Zahntechniker in der Speakers’ Corner zu aktuellen Themen
referieren.
Under the headline “Best of both
worlds”, GC sets new standards with
its latest digital workflows by introducing the Aadva IOS 200 that features innovative and unique four-dimensional regression (4DR) technology.
With the 4DR technology, GC introduces an advanced technology in
intra-oral scanning. A strong and robust method for calculating 3D images is a key requirement for any intra-oral scanner. The Aadva IOS 200
uses an entirely new stereo-matching
technology designed specifically for
use in clinical dentistry. It transfers
three-dimensional shapes into a fourdimensional space in order to overcome traditional challenges in digital
impression taking, such as reflections,
saliva and translucencies.
Aadva IOS 200 uses stereo technology for its 3D measurement which
allows a much slimmer, smaller and
lighter scanner handpiece (about 120 g).
This results in an enhanced ease of
40th International Dental Show 2023 • 14. März 14 March
use for the dentist, more comfort for
the patient and easier access not only
to difficult-to-reach areas, such as the
distal molar region, but also pediatric
dentition and patients with limited
mouth opening. The autoclavable tip
(about 30 g) minimises the risk of
cross infection.
All dental professionals are invited to experience the benefits of the
new GC’s workflows and solutions at
the booth during hands-on courses
and lab demos. In addition, internationally renowned dentists and dental
technicians are presenting daily lectures on current topics at the speakers’
corner.
GC Europe, Belgium
www.gc.dental/europe
Hall 11.2
Booth N010/O039
[59] =>
untitled
industry
59
WELTWEIT FÜHRENDE DENTALE 3D-DRUCKLÖSUNG VON SPRINTRAY FÜR VOLLSTÄNDIGE DIGITALE INTEGRATION
SPRINTRAY’S WORLD-LEADING DENTAL 3D-PRINTING SOLUTION FOR COMPLETE DIGITAL INTEGRATION
SprintRay ist ein Unternehmen der
Digitalen Zahnmedizin, das Chairside3D-Drucklösungen anbietet, unter
anderem für die Herstellung von
Kronen und Nightguards. SprintRay
freut sich, auf der IDS seine verbesserten End-to-End-Workflows vorstellen zu können.
„Mit unserem neuen Crown Kit
ist es jetzt möglich, Kronen in weniger als 15 Minuten zu drucken. Mit
AI Cloud Design und einem Polierset
zur Individualisierung der Kronen
kann der gesamte Arbeitsablauf von
der Datenerfassung bis zur Auslieferung an den Patienten innerhalb einer
Stunde erledigt werden, was dies zur
ersten echten Chairside-3D-Drucklösung macht“, sagt Amir Mansouri,
CEO von SprintRay. „Wir sind außerdem stolz darauf, unser neuestes Material Ceramic Crown vorzustellen,
ein Hybridkronenmaterial für definitive Versorgungen mit einem Keramikanteil von mehr als 50 Prozent,
wodurch 3D-gedruckte Kronen für
die Erstattung durch das US-Gesundheitssystem infrage kommen.“
Bruxismus ist eine weltweit verbreitete Krankheit. Mit einem AI-Design und den bewährten Kunstharzen SprintRay Nightguard Flex und
Nightguard Firm möchte SprintRay
Zahnärztinnen und Zahnärzten helfen,
das Lächeln ihrer Patientinnen und
Patienten zu schützen. „Wir freuen
uns, dass wir unseren europäischen
Kunden unsere neuesten NightguardMaterialien anbieten können. Wir
präsentieren ein Material, das langlebig und dennoch flexibel ist, was
es zu einem der Favoriten der Patienten auf der ganzen Welt macht“, sagt
Patrick Thurm, Geschäftsführer von
SprintRay Europe.
Neben hochwertigen Materialien für Zahnersatz, Bohrschablonen, Try-Ins und vielem mehr,
bietet SprintRay für viele Anwendungen einen Designservice an, um die Umset-
zung in der Zahnarztpraxis so einfach
wie möglich zu gestalten.
Mit einem umfassenden Produktportfolio von 3D-Druckern, automatisierten Wasch- und Trocknungs- sowie Nachhärtungssystemen bietet
SprintRay intuitive und zuverlässige
3D-Drucklösungen exklusiv für die
Dentalbranche. Die intelligente SlicingSoftware RayWare, SprintRay- und
Partnerharze sowie die Cloud Design
Services machen SprintRay zum
Partner der Wahl für Zahnarztpraxen und Labore auf der ganzen Welt.
Um digitale Workflows noch
weiter zu vereinfachen, präsentiert
SprintRay das SprintRay CloudDrive,
ein Integrationstool, das alle intraoralen Scans an einem Ort speichert
und organisiert, sodass sie leicht zugänglich sind und in Design-Softwares weiterverwendet oder an
Cloud Design Services gesendet werden können.
SprintRay is a digital dentistry company that offers chairside 3D-printing solutions, including for fabrication of crowns and night guards. The
company is pleased to present its enhanced end-to-end workflows at IDS.
“With our new crown kit, it is now
possible to print crowns in less than
15 minutes. With SprintRay Cloud Design and a polishing kit to individualise
the crowns, the complete workflow,
from data capture to delivery to the
patient, can be done within an hour,
making this the first true chairside
3D-printing solution,” said SprintRay
CEO Amir Mansouri.
“We also are proud
to present our latest
material, Ceramic
Crown, a hybrid crown material for
definitive restorations with a composition of more than 50% ceramic filler
particles, making 3D-printed crowns
eligible for reimbursement through the
US healthcare system,” he continued.
Bruxism is a common parafunction worldwide. With artificial intelligence-driven design and the proven
SprintRay Nightguard Flex and Nightguard Firm resins, SprintRay aims to
help dental professionals protect their
patients’ smiles. “We are happy to be
able to offer our latest night guard
materials to our European customers.
We present a material that is durable
yet flexible, making it a patient favourite
around the world,” stated Patrick Thurm,
general manager of SprintRay Europe.
Besides high-quality materials for
dentures, surgical guides, wax-ups and
many more indications, SprintRay offers a design service for many applications to make implementation in
the dental clinic as easy as possible.
With a full product portfolio
for 3D printing, automated washing
and drying, and post-polymerisation,
SprintRay offers intuitive and reliable
3D-printing solutions exclusively for
dental professionals. The RayWare
smart slicing software, SprintRay and
partner resins, and SprintRay Cloud
Design services make SprintRay the
partner of choice for dental practices
and laboratories around the world.
To simplify full digital workflows
even further, SprintRay is proud to
present SprintRay CloudDrive, an integration tool that will store and organise all intra-oral scans in one
place, thus facilitating access and further use in design software.
SprintRay, USA
www.sprintray.com
Hall 3.1
Booth H010/J029
AD
Now, the next breakthrough is here.
U . S . P AT E N T N O 1 1 , 1 1 6 , 7 0 1 B 2
Learn more: Hall 10.1, Stand A021
40th International Dental Show 2023 • 14. März 14 March
For more information, email contact@pulpdent.com or visit pulpdent.com
For more information, email contact@pulpdent.com or visit pulpdent.com
80 Oakland Street • Watertown, MA 02472 • USA
80 Oakland Street • Watertown, MA 02472 • USA
[60] =>
untitled
industry
60
W&H AUF DER IDS 2023 – MESSEHIGHLIGHTS UND PRODUKTNEUHEITEN
W&H AT IDS 2023—TRADE FAIR HIGHLIGHTS AND NEW PRODUCTS
Knopfdruck perfekt aufbereitet und
gepflegt werden. Das Pflegegerät dosiert automatisch die exakte Menge
an W&H Service Oil sowie W&H
Activefluid. Auf diese Weise werden
Ressourcen und Kosten gespart und
Instrumente nachhaltig aufbereitet
und gepflegt.
„We enjoy providing sustainable
health solutions. Für uns bedeutet
das, mit Ambition innovative Produkte für nachhaltige Gesamtlösungen im Gesundheitsbereich zu entwickeln“, erklärt W&H Geschäftsführer Peter Malata.
IDS Highlights
W&H Geschäftsführer Peter Malata. W&H’s Managing Director Peter Malata.
Die Top-Player der Dentalbranche
treffen sich in Köln und stellen neue
Produkte, zukunftsweisende Technologien und innovative Konzepte
für Zahnarztpraxen und Labore vor.
Gemäß W&H Messemotto „From innovative products to sustainable solutions“ präsentiert W&H nachhaltige Produkt- und Servicelösungen.
An den W&H Messeständen können Besucherinnen und Besucher
neben zahlreichen Produktinnovationen auch erstmalig den W&H ProService live erleben. Attraktive Messeangebote, digitale Highlights und an-
sprechende Produktpräsentationen
runden den Messeauftritt des Medizinprodukteherstellers ab.
Im Mittelpunkt des W&H Messeauftritts stehen die nachhaltigen Produktlösungen des Medizinprodukteherstellers: vom Piezomed Modul
über die Lara XL bis zur Assistina
One. Aber was macht diese Produkte,
abgesehen von der Top-Qualität, den
hochwertigen Materialien und der
langen Lebensdauer besonders nachhaltig?
Das Piezomed Modul, die W&H
Produktneuheit in der Oralchirurgie,
überzeugt durch seine Modularität,
die es ermöglicht, das Gerät an die
individuellen Anforderungen der Anwenderinnen und Anwender anzupassen. Bei der Lara XL hat W&H
vorausgedacht: Die fortschrittliche
Technologie des Sterilisators ist darauf ausgelegt, sich an zukünftige
Anforderungen anzupassen und gewährleistet sowohl umfassende Konnektivität als auch Upgrade-Fähigkeit. Mit der Assistina One können
Hand- und Winkelstücke, Turbinen,
Luftmotoren und luftbetriebene Zahnsteinentfernungsinstrumente auf
The dental industry’s key players
meet in Cologne and showcase new
products, forward-thinking technologies and innovative concepts for dental practices and laboratories. Under
the W&H trade fair slogan “From
innovative products to sustainable
solutions”, W&H’s appearance at the
trade fair focuses on its sustainable
product and service solutions.
Visitors to the W&H booths are
able to experience the W&H ProService
live for the first time, as well as numerous product innovations. The medical device manufacturer is also
showcasing attractive special offers
for the trade fair, digital highlights,
and interesting product presentations.
W&H’s trade fair appearance focuses on the medical device manufacturer’s sustainable product solutions, from the Piezomed module to
the Lara XL and Assistina One. However, what makes these products particularly sustainable besides their
superior quality, high-class materials
and long lifespan?
The Piezomed module, W&H’s
product innovation in the area of oral
surgery, impresses with its modular
design, which allows the device to
be adapted to users’ specific requirements. The Lara XL has been developed by W&H with one eye to the future: the state-of-the-art technology
inside the sterilizer has been designed in such a way that it can be
adapted to future requirements and
therefore guarantees extensive connectivity and upgradeability. Straight
and contra-angle handpieces, turbine
handpieces, air motors and air-powered scalers can be perfectly processed and maintained at the push
of a button using the Assistina One.
This maintenance device automatically dispenses the exact amount of
W&H Service Oil and W&H Activefluid required. This means instruments can be sustainably maintained
while also saving on both resources
and costs.
“We enjoy providing sustainable
health solutions. At W&H, our ambition is to develop innovative products
for sustainable overall solutions in
the healthcare sector,” explains W&H’s
Managing Director Peter Malata.
W&H Group, Austria
www.wh.com
Hall 10.1
Booth A020/B029, A002
3DISC ERFINDET INTRAORALEN SCANNER MIT OVO NEU
3DISC REINVENTS THE INTRA-ORAL SCANNER WITH OVO
Nach der Einführung des Intraoralscanner HERON IOS der bereits
2022 von Zahnärztinnen und Zahnärzten zum zweitbeliebtesten Intraoralscanner gewählt wurde, erweitert 3DISC nun sein Produktportfolio durch die Markteinführung
von OVO, ein Produkt, das den Intraoralscanner neu erfindet.
Seit dem Einzug der Digitalisierung in die Zahnarztpraxis sind Intraoralscanner die wichtigste digitale Innovation der letzten zehn
Jahre. Dank der gesteigerten Präzision, der Geschwindigkeit der Bilderfassung und der Möglichkeit, Zahnabdrücke mit nur wenigen Klicks
an Dentallabore zu senden, bietet
diese Technologie Zahnärztinnen
und Zahnärzten sowie ihren Patientinnen und Patienten einen echten Mehrwert.
OVO ist eine technologische Revolution sowohl in Bezug auf die
Hardware als auch auf die Software,
dank der integrierten 2D-Kamera
und der Scan&Tell-Kommunikationssoftware mit Smile Design und Buccal Monitoring.
OVO ist ein klinisches Kommunikationstool, das es Zahnärztinnen
und Zahnärzten ermöglicht, gemeinsam mit ihren Patientinnen und Patienten deren Gebiss und die möglichen Behandlungsempfehlungen zu
Marie-Laure Pochon, Geschäftsführerin von 3DISC, kommentiert:
„OVO ist eine große Bereicherung
für 3DISC. Wir sind damit anderen
Scannern einen Schritt voraus. Wir
bieten den Patienten einen neuen
Komfort und optimieren die Beziehung zwischen Zahnärzten und Patienten. Dies ist ein grundlegendes
Ziel von 3DISC, für das die Gesundheit der Zähne ein wichtiger Indikator für das Wohlbefinden des Patienten ist.“
visualisieren. Diese interaktive Visualisierung erfolgt über ein Tablet,
das 3D-Abdrücke, 2D-Bilder und die
Behandlungspläne zeigt. Sie ermöglicht es den Patientinnen und Patienten, ihre Situation und die möglichen
Behandlungsoptionen besser zu verstehen und die bestmögliche Entscheidung zu treffen.
Neben der Übermittlung von
3D-Dateien an die Labore wird OVO
auch die Möglichkeit bieten, eine digitale Zusammenfassung mit Bildern
an die Patientinnen und Patienten zu
senden. Nach Aussagen von Anwenderinnen und Anwendern von OVO
wird das Gerät die tägliche Arbeit in
der Praxis prägen.
Though the intra-oral scanner
HERON IOS was voted the second
most popular intra-oral scanner by
dentists in 2022, 3DISC will enhance
its range by launching OVO, a product to reinvent the intra-oral scanner.
Intra-oral scanners have been the
greatest digital innovation of the last
ten years, perhaps since the advent of
digital dentistry. Thanks to increased
precision, speed of image acquisition
and just a few clicks to send dental impressions to dental laboratories, this
technology offers real assistance to
dentists, specialists and their patients.
OVO is a technological revolution
in both hardware and software
thanks to the integrated 2D camera
and the Scan&Tell communication
software suite with smile design, buccal monitoring and more.
40th International Dental Show 2023 • 14. März 14 March
OVO is a clinical communication
tool allowing dentists and patients to
visualise dentition and possible treatments. This new, interactive visualisation is shared via a tablet showing
3D impressions, 2D images and the
dentist’s recommendations. It will
allow patients to better understand
their situation and treatment options
to make the best possible decision. In
addition to sending 3D files to the laboratories, OVO can send a digital summary including images to patients.
According to dentists who have used
OVO, it is a system that will be used
daily.
Marie-Laure Pochon, president of
3DISC says: “This new OVO scanner
is a major feat for 3DISC. We are taking a step ahead of other scanners.
We are bringing a new level of comfort to patients and improving the relationship between dentists and patients. This is a fundamental element
for 3DISC, for whom the health of the
teeth is a vital indication of the patient’s wellbeing.”
3DISC, USA
www.3disc.com
Hall 10.2
Booth M051
[61] =>
untitled
.1
0
1
:
l
l
a
H
t
a
s
9
u
2
t
0
i
s
i
C
V
8
2
0
B
:
Stand
[62] =>
untitled
industry
62
AUFGABE GELÖST – MIT GC! SOLVED WITH GC!
GC konzentriert sich auf Lösungen
und verhilft Zahnärztinnen und
Zahnärzten zu mehr Effi zienz und
vorhersagbaren Ergebnissen, und
damit zu mehr Erfolg. Bei der Produktentwicklung achtet GC besonders auf eine einfache Handhabung.
Das verkürzt die Behandlungszeiten
– ohne Kompromisse beim Endergebnis. Alle Produkte von GC sind optimal aufeinander abgestimmt. Wenn
man sie miteinander kombiniert,
kommen sämtliche Vorteile zum
Tragen.
geht darum, potenzielle Probleme zu
erkennen, ihr Auftreten zu verhindern und bereits entstandene Schäden minimalinvasiv zu reparieren.
Dazu gehört das Erkennen aktiver Plaque als Schlüssel zur Motivation von Patientinnen und Patienten. GC Tri Plaque ID Gel ist ein
dreifarbiges Plaque-Gel, das Anwenderinnen und Anwendern hilft, Risikobereiche im Mund zu identifizieren.
Dieses Gel kann die Patienten-Compliance verbessern und zur Prävention oraler Probleme beitragen.
aus Milch gewonnen wird. Seit vielen Jahren ist bekannt, dass das in
der Milch enthaltene Casein eine
zahnschützende Wirkung hat. Studien haben gezeigt, dass diese Wirkung auf einen Bestandteil des
Caseins – das Caseinphosphopeptid –
zurückzuführen ist, das Calcium- und
Phosphationen als bioverfügbares
amorphes Calciumphosphat enthält.
Obwohl Fluorid als Eckpfeiler der
nicht invasiven Kariestherapie gilt,
wird seine Fähigkeit, die Netto-Remineralisation zu fördern, durch die
1
2
3
1: TriPlaque ID Gel (© Dr P. Rouas). 2: GC MI Paste Plus (©Dr D. Mahoney). 3: EQUIA Forte HT (©Dr M. Galal).
Das Minimum-Intervention-(MI-)
Konzept von GC zielt darauf ab, den
ewigen Kreislauf von Reparaturen
und Neuanfertigungen zu durchbrechen und verfolgt einen proaktiven
Ansatz für die Mundgesundheit. Es
Lösungen von GC helfen jedoch
nicht nur bei der Identifizierung von
Risikobereichen, sondern auch bei
der Vorbeugung von Zahnproblemen.
GC MI Paste Plus und GC Tooth Mousse
enthalten Recaldent, ein Peptid, das
Verfügbarkeit von Calcium- und Phosphationen eingeschränkt. Recaldent
maximiert in Synergie mit Fluorid
die Kariesprävention. Beide spielen
auch eine wichtige Rolle bei der Vorbeugung von Hypersensibilitäten
und bei der Behandlung von Patientinnen und -Patienten mit einer
Molaren-Inzisiven-Hypermineralisation.
Bei der Restauration von Zähnen
ist es wichtig, minimalinvasiv vorzugehen, um die Lebensdauer der
Zähne zu verlängern. EQUIA Forte
HT (Fil und Coat) ist eine kosteneffiziente Langzeit-Restaurationsalternative mit verbesserten mechanischen und hervorragenden Bulk-FillEigenschaften sowie verbesserter
Transluzenz. Die einzigartige GlasHybrid-Technologie mit intelligenter
Füllstoffverteilung und synergistischem Coating macht EQUIA Forte
HT zu einem vielseitigen und dauerhaften Restaurationsmaterial – für
Patientinnen und Patienten jeden
Alters, mit hohem Kariesrisiko oder
mit besonderen Bedürfnissen.
Alle Dentalfachleute sind eingeladen, die Vorteile der Arbeitsabläufe
und Lösungen von GC in live stattfindenden Hands-on-Kursen direkt zu
erleben – auf der IDS am Messestand. Dort werden auch täglich international renommierte Zahnärzte und Zahntechniker in der
Speakers’ Corner zu aktuellen Themen referieren.
By focusing on solutions rather
than problems, GC helps dentists
achieve success with greater efficiency and predictability. By designing easy-to-use products, we can help
you reduce your working time without compromising on the result. All of
our products are optimally coordinated. When used in combination,
you take full advantage of our solution workflows.
Our Minimum Intervention (MI)
solutions aim to break the cycle of repair and repeat, offering a proactive
approach to oral healthcare. Our
products are designed to identify potential issues, prevent them from occurring, and restore any damage that
may have already occurred in a minimally invasive manner.
Identifying active plaque can be
key to motivate your patients. The GC
Tri Plaque ID Gel is a three-tone
plaque disclosing gel that helps dentists and dental hygienists identify
risk areas in the mouth. By using this
gel, practitioners can increase patient
compliance and take a proactive approach to preventing oral health issues.
In addition to identifying risk areas, GC offers solutions for preventing dental problems. GC MI Paste Plus
and GC Tooth Mousse contain
Recaldent, which is a milk-derived
peptide. For many years, it has been
known that milk casein has a
tooth-protective effect. Research has
attributed this beneficial effect to that
the casein protein casein phosphopeptide that carries calcium and
phosphate ions in the bioavailable
form of amorphous calcium phosphate. While fluoride is considered a
cornerstone of non-invasive caries
management, the ability of the ion to
promote net remineralisation is limited by the availability of calcium and
phosphate ions. Recaldent works in
synergy with fluoride, and together
they maximise caries prevention.
They also play an important role in
the prevention of hypersensitivity
and the treatment of patients with
molar incisor hypomineralisation.
When it comes to restoring teeth,
using an minimally invasive procedure is important to increase the longevity of the tooth. EQUIA Forte HT
(Fil and Coat) is a cost-effective, longterm restorative alternative with enhanced mechanical properties, excellent bulk fill application and improved
translucency. The unique glass hybrid technology with intelligent particle size distribution and synergistic
coat makes the EQUIA Forte HT restorative system a versatile and durable restorative solution, ideal for patients of all ages, with high caries risk
or special needs.
All dental professionals are invited to experience the benefits of all
our workflows and solutions at the
booth during hands-on courses and
lab demos. Additional booth experience will include internationally renowned dentists and technicians
daily presenting on current topics
of interest on the booth at the speakers’ corner.
GC Europe, Belgium
www.gc.dental/europe
Hall 11.2
Booth N010/O039
NEOSS BIETET INTELLIGENTEN, PATIENTENFREUNDLICHEN UND EFFIZIENTEN ARBEITSABLAUF
NEOSS OFFERS SMART, PATIENT-FRIENDLY AND EFFICIENT WORKFLOW
Die ästhetischen Heilungsabutments mit ScanPeg von Neoss sind
eine Kombination aus Gingivaformer
und Scanabutment in einer revolutionären 2-in-1-Lösung. Dies ist eine vereinfachte, patientenfreundliche Lösung für genaues und einfaches
intraorales Scannen. Die Verwendung der ästhetischen Heilungsabutments mit ScanPeg spart nicht nur
Zeit und Geld, sondern schont auch
das Weichgewebe, da die biologische
Versiegelung intakt bleibt, wenn der
Gingivaformer beim Scannen nicht
entfernt wird. Diese Lösung ist nicht
nur für den einmaligen Gebrauch er-
hältlich. Sie können sie auch für das
Scannen Ihrer Brückenrestauration
verwenden.
Überzeugen Sie sich noch heute
am Neoss-Messestand.
The Neoss Esthetic Healing Abutments with ScanPeg are a combination of healing abutment and scan
abutment in a revolutionary two-inone solution. It is a simplified, patient-friendly solution for accurate
and effortless intra-oral scanning.
Using the Esthetic Healing Abutments with ScanPeg will help clinicians save time and money. As the
40th International Dental Show 2023 • 14. März 14 March
healing abutment does not have to be
removed for the scan process, biological seal remains intact, which helps
preserve the soft tissue. You can also
use it for your bridge restoration
scans.
Make sure to check it out today at
the Neoss booth.
Neoss, Switzerland
www.neoss.com
Hall 11.3
Booth G010/H029
[63] =>
untitled
View details of the programme
on our website and register now.
world-dental-congress.org
WIN
a free registration and
airfare to Sydney! Visit us at booth
N069 and enter our lucky draw.
WORLD
DENTAL
CONGRESS
SYDNEY 2023
SUN 24 - WED 27 SEPTEMBER
Register now for the premier dental event of 2023.
Enjoy a 4-day scientific programme with leading
speakers from across the globe, a 25,000sqm
exhibition with the latest in dental products and
services, and rich socialising opportunities right
in the heart of Australia’s harbour city.
[64] =>
untitled
industry
64
FEIERN SIE 100 JAHRE IDS UND 30 JAHRE BEGO
IMPLANTATGESCHICHTE MIT UNS
CELEBRATE 100 YEARS OF IDS AND 30 YEARS
OF BEGO IMPLANT SOLUTIONS WITH US
Bei BEGO erhalten Sie
sämtliche Produkte für
eine flexible und sichere
Komplettversorgung aus
einer Hand – von der Planung bis zur Prothetik. Unsere Fachkompetenz über
den gesamten digitalen Workflow mit integrierten, aufeinander abgestimmten Produktund Servicelösungen sind
„made in Germany for the
world“ und runden unser Angebot ab. Einzigartig umfassend ist auch das Garantieprogramm von BEGO, das
neben dem Gratisschutz der
BEGO Security Basic die
Rundum-sorglos-Garantie
BEGO Security Plus beinhaltet.
Als absolutes Highlight auf der IDS 2023 präsentieren wir Ihnen in unserer Live-Arena erstmalig
die Welt des SMART Veneerings. Entdecken Sie die unglaubliche Vielzahl von einzelnen Lösungsansätzen für einen
ganzheitlichen Workflow. Sie
können spannende Workshops
erleben und selbst aktiv werden.
TREFFEN SIE VAN DER VEN AUF DER IDS MEET VAN DER VEN AT IDS
Besuchen Sie unseren Stand,
feiern Sie mit uns und entdecken Sie
unsere Jubiläumsangebote.
BEGO is your full-service provider
for flexible and safe complete restorations―from surgical planning to
prosthetics. Our dental expertise
throughout the entire digital workflow with integrated, well-coordinated product and service solutions
that are “made in Germany for the
world” complement our portfolio.
Get to know the unique, all-round
carefree guarantee for BEGO implant restorations.
A highlight at IDS 2023 is our
live arena, at which we are presenting the world of SMART Veneering
for the first time. Discover the incredible variety of individual solutions
for a holistic workflow. You will have
the opportunity to attend exciting
workshops and get involved yourself.
Visit our booth, celebrate with us
and discover our anniversary offers.
BEGO, Germany
www.bego.com
Hall 10.2
Booth M010/N019
Am van der Ven Stand werden
die Kundinnen und Kunden persönlich durch die Fachberaterinnen
und Fachberater des Unternehmens
beraten und können sich über das
van der Ven-Bonusheft Messerabatte
für Material und Kleingeräte anrechnen lassen. Für größere Anschaff ungen können die van der
Ven-Investitionsschecks in Anspruch
genommen werden. Mit dem van der
Ven-Messe-Guide erhalten Messegäste außerdem eine VIP-Behandlung mit exzellenter Beratung.
Darüber hinaus besteht ab morgen täglich die Gelegenheit, bei einer moderierten Fragerunde den
anwesenden CEOs der großen Hersteller Fragen zu stellen. Morgen gibt
es zwei verschiedene Fragerunden:
von 11:00 bis 12:00 Uhr mit Haleh
und Golnar Abivardi von vVARDIS
und von 15:00 bis 16:00 Uhr mit
Walter Dürr von Dürr Dental.
At the van der Ven booth, customers will receive personal advice from
the company’s expert consultants
and can use the van der Ven bonus
booklet to receive trade show discounts on materials and small equipment. For larger purchases, visitors
to IDS can make use of investment
cheques provided by van der Ven.
With the van der Ven trade fair
guide, visitors also receive VIP treatment combined with excellent advice.
In addition, starting tomorrow,
visitors will have the opportunity to
ask the CEOs of major manufacturers questions at a daily Q & A session. Tomorrow, there will be two Q &
A sessions. The first one will take
place from 11:00 to 12:00 with Haleh
Abivardi and Golnar Abivardi from
vVARDIS and the second one from
15:00 to 16:00 with Walter Dürr from
Dürr Dental.
van der Ven, Germany
www.vanderven.de
Hall 10.1
Booth E080/F089
AD
The 26
th
China International Exhibition & Symposium on
Dental Equipment, Technology & Products
October 14 - 17, 2023
Shanghai World Expo Exhibition and Convention Center
Follow us on
DenTech China
40th International Dental Show 2023 • 14. März 14 March
DenTech China
DenTech China
[65] =>
untitled
[66] =>
untitled
news
66
Dentaltechnologie und Nachhaltigkeit: Ein großer Schritt in die Zukunft
Dental technology and sustainability: The great leap forward
© Dentsply Sirona
In den letzten Jahrzehnten hat die
Zahnmedizin große Entwicklungsschritte erlebt. Heutzutage ist es
schwierig, sich vorzustellen, wie es
früher war, als es noch keine modernen Technologien wie CAD/CAM
und Intraoralscanner gab. Auch die
gesellschaftlichen Veränderungen haben Einfluss auf die Entwicklung
der Zahnmedizin. Die Branche ist
umweltbewusster geworden und viele
Zahnarztpraxen haben bereits die
4 Rs der Nachhaltigkeit umgesetzt
oder sind dabei, dies zu tun – reduce
(reduzieren), reuse (wiederverwenden), recycle (wiederverwerten) und
rethink (umdenken). Dies sind unverzichtbare Säulen einer nachhaltigen Zahnmedizin.
Recycling, den Kraftstoffverbrauch
der Firmenfahrzeuge kontrollieren,
für die Wartung und Reparatur von
zahnmedizinischen Geräten Sorge tragen, Kohlendioxidemissionen sowie
die Wasserentnahme für Produktions- und Lagertätigkeiten verringern, umweltfreundliche zahnmedizinische Produkte anbieten und Technologien wie Telezahnmedizin, Zahnröntgenaufnahmen, Dampfsterilisation
und Praxisverwaltungssoftware nutzen – dies sind nur einige Wege, die
Dentalunternehmen wie Dentsply
Sirona und Henry Schein gehen, um
zukunftsorientierter und umweltfreundlicher zu werden.
Im Zuge einer nachhaltigen Entwicklung hat Dentsply Sirona, der
weltweit größte Hersteller von professionellen zahnmedizinischen Produkten und Technologien, im Jahr
2021 seine Nachhaltigkeitsstrategie
BEYOND eingeführt. Diese spiegelt
die Bemühungen des Unternehmens
im Bereich Umwelt-, Sozial- und Unternehmensführung wider.
„Angesichts der großen Herausforderungen im Bereich Umwelt, Soziales und Wirtschaft, mit denen die
Welt konfroniert wird, ist die Zeit gekommen, dass wir uns alle gemeinsam für Nachhaltigkeit einsetzen und
das Tempo beschleunigen“, so Cherée
H. Johnson, Chief Legal Officer und
© Henry Schein
Technologie ist mittlerweile untrennbar mit Nachhaltigkeit in der Zahnarztpraxis verbunden. Von Iveta Ramonaite, Dental Tribune International
Technology has become inextricably intertwined with sustainable dental practice. By Iveta Ramonaite, Dental Tribune International
1
2
1: Cherée H. Johnson, Chief Legal Officer und Vorsitzende des Ausschusses für Umwelt, Soziales und Unternehmensführung bei Dentsply Sirona.
2: Jennifer Kim Field, Chief Sustainability Officer bei Henry Schein.
1
: Cherée H. Johnson, Dentsply Sirona’s chief legal officer and chair of its environmental, social and corporate governance committee. 2: Jennifer Kim
Field, chief sustainability officer at Henry Schein.
Vorsitzende des Ausschusses für Umwelt, Soziales und Unternehmensführung bei Dentsply Sirona. „Wir bei
Dentsply Sirona sind überzeugt, dass
es als Marktführer unsere Verantwortung ist, den Übergang zu einer nachhaltigen Zahnheilkunde voranzutreiben. Und Innovation ist der Motor
dieser Veränderung, sei es durch digitale Neuheiten, verbesserte Verfahren oder verändertes Verhalten“,
fügte sie hinzu.
Henry Schein, ein globaler Dentalhändler und Anbieter von Lösungen im Gesundheitswesen, strebt an,
bis 2050 kohlenstoffneutral zu sein.
Zudem engagiert sich das Unternehmen für umweltfreundliche Geschäftspraktiken bei seinen Kunden.
„Nachhaltigkeit ist für Henry
Schein nichts Neues. Seit unserer
Gründung im Jahr 1932 hat Henry
Schein danach gestrebt, ein Vorbild
für andere zu sein. Wir sind überzeugt, das wenn wir Gutes für unsere Interessensvertreter tun, es auch
unserem Unternehmen gut geht“, so
Jennifer Kim Field, Chief Sustainabi-
lity Officer bei Henry Schein. „Wir
befinden uns in einer besonderen
Position innerhalb eines Ökosystems
von Beziehungen zu Lieferanten, Geschäftspartnern und Kunden, und
wir sind uns bewusst, welche möglichen Auswirkungen das Gesundheitswesen auf den Klimawandel haben kann. Das betrifft auch die Konsequenzen, die sich aus dem Klimawandel für die Gesundheit im Allgemeinen ergeben. In einer Branche,
die laufend neue und verbesserte Lösungen erfindet, ist Nachhaltigkeit ein
entscheidender Schritt in jeder Phase
des Lebenszyklus einer zahnmedizinischen Innovation. Nachhaltigkeit
sollte dieselbe Aufmerksamkeit bekommen wie hohe klinische Standards und die aktuellen Gesundheitsund Sicherheitsvorschriften“, so Field
weiter.
Konventionelle Verfahren durch
digitale Ansätze und Hightech-Lösungen zu ersetzen, ermöglicht es Praxen, zu wachsen und nachhaltiges
Arbeiten sicherzustellen. Dies ist
auch im Interesse der Patienten und
Kunden. Field formulierte es folgendermaßen: „Digitalisierung in der
Zahnmedizin ist eine der zentralen
Veränderungen, die dabei helfen kann,
dass Zahnarztpraxen nachhaltiger arbeiten.“
Dentistry has experienced major
evolutionary jumps in the last decades, and it is now difficult to imagine
going back to the old ways of practising the craft without state-of-the-art
technology such as CAD/CAM and intra-oral scanners. Reflecting societal
changes, dentistry has also become a
more environmentally conscious profession, and many dental practices
have implemented or started working
towards implementing the four Rs—
reduce, reuse, recycle and rethink—
which are indispensable pillars of sustainable dentistry.
Recycling, managing fleet fuel
consumption, providing dental equipment maintenance and repair services, reducing carbon dioxide emissions and reducing water withdrawal
for manufacturing and warehouse
40th International Dental Show 2023 • 14. März 14 March
operations, offering environmentally
friendly dental products and making
use of technology such as teledentistry, dental radiography, steam sterilisation and practice management
software—these are just some ways
that various dental companies, such
as Dentsply Sirona and Henry Schein,
are striving to become more forwardthinking and eco-friendly.
For example, in line with sustainable development, Dentsply Sirona,
the world’s largest manufacturer of
professional dental products and technologies, launched its sustainability
strategy, BEYOND, in 2021, which reflects the environmental, social and
governance aspects of the company’s
endeavours.
“Given the major environmental,
social and economic challenges our
world is facing, the time has come for
all of us to join hands to accelerate
our sustainability efforts,” commented
Cherée H. Johnson, Dentsply Sirona’s
chief legal officer and chair of its
environmental, social and corporate
governance committee. “At Dentsply
Sirona, we believe it is our responsibility as a market leader to drive the
transition towards sustainable dentistry, and innovation is the driver of
this change, be it through digital innovation, enhanced protocols or changed
behaviour,” she added.
Similarly, Henry Schein, a global
dental distributor and healthcare solutions company, aspires to be carbonneutral by 2050 and champions environmentally friendly business practices among its customers.
“Sustainability is not new for
Henry Schein. Since our founding in
1932, Henry Schein has striven to
be a model corporate citizen. We believe that by doing good for our
stakeholders our company will do
well,” stated Jennifer Kim Field,
chief sustainability officer at Henry
Schein. “We are in a unique position
within an ecosystem of relationships
with suppliers, business partners
and customers, and we are aware of
the potential impact the healthcare
industry can have on climate change
and the subsequent consequences
that climate change can have on
health. As an industry that is continuously inventing new and improved
solutions, sustainability is a crucial
step in each stage of the full life cycle
of dental innovation. It should receive equal attention to that given to
achieving high standards of clinical
excellence and the current health
and safety legislation,” she continued.
Substituting conventional methods with digital approaches and hightech solutions allows practices to
grow and ensures the delivery of sustainable practices, which is also in
line with patient and customer values.
As Field correctly put it: “Digitalisation in dentistry is one of the most
pivotal and evolutionary changes that
can help dental teams run a more sustainable practice.”
[67] =>
untitled
[68] =>
untitled
industry
68
ALLISONE VERBESSERT DIE EINHALTUNG VON BEHANDLUNGSPLÄNEN MIT KÜNSTLICHER INTELLIGENZ
ALLISONE BOOSTS TREATMENT PLAN ADHERENCE WITH AI
und Patienten in die Behandlung einzubeziehen und so die Befolgungsrate des Behandlungsplans zu erhöhen. Besuchen Sie Allisone
auf der IDS 2023 für eine kostenlose Demonstration und Sonderangebote.
Allisone repräsentiert das Beste aus menschlicher und künstlicher Intelligenz (KI). Allisone
ist eine Software as a Service-Anwendung
(SaaS) die KI-Technologien nutzt, einschließlich
Deep Learning und Computer Vision, um Elemente auf Röntgenbildern hervorzuheben, wie
frühere Behandlungen, Röntgenstrahlen.
Allisone besteht aus einer einfachen und
intuitiven Schnittstelle, die Zahnärztinnen
und Zahnärzten hilft, ihren Patientinnen und
Patienten Röntgenbilder mithilfe eines Farbcodes zu erklären. Der Hauptzweck dieser
Funktionalität besteht darin, die Erklärungen
durch visuelle Darstellungen zu unterstützen,
damit Patientinnen und Patienten den Zustand
ihrer Mundgesundheit visualisieren und verstehen können.
Das Patientenverständnis und die Aufklärung am Behandlungsplatz sind entscheidend
für die Einhaltung des Behandlungsplans.
Durch die Hervorhebung der Elemente auf
dem Röntgenbild und dank der Allisone-Behandlungsillustrationen sind Behandlerinnen
und Behandler in der Lage, die Fragen von Patientinnen und Patienten schnell und einfach
zu beantworten. So können sich Patientinnen
und Patienten die Erklärungen ihres Arztes
leicht vorstellen und die potenziellen Vorzüge
und Risiken der vorgeschlagenen Behandlung
besser verstehen. Klarheit trägt dazu bei, Patientinnen und Patienten voll in den Behandlungsplan einzubeziehen, und erhöht das Vertrauen in die Behandlung erheblich.
Durch die intuitive Handhabung von
Allisone können Zahnärztinnen und Zahnärzte
die Effizienz in der täglichen Praxis verbessern. Mit wenigen Klicks kann ein idealer
Behandlungsplan erstellt werden. Der Bericht
und weitere Informationen können anschließend ausgedruckt und an die Patientin oder
den Patienten gesendet werden. Die mitgelieferten Aufklärungsbögen helfen, die Diagnose
zu verstehen und zu visualisieren. Illustrationen der Behandlung und des Behandlungsergebnisses helfen, die vorgeschlagene Behandlung zu verstehen.
Dank der Digitalisierung der Patientenakte
werden die Zusammenarbeit und die Datenübertragung innerhalb der Praxis sowie zwischen Geräten und Behandlerinnen und Behandlern vereinfacht. Somit kann die Effizienz
der Praxis gesteigert und gleichzeitig das Patientenerlebnis verbessert werden.
Allisone ist von Haus aus mit der Röntgensoftware kompatibel und kann in eine
Vielzahl von Patientenverwaltungssoftwares
integriert werden. Die Interoperabilität ermöglicht es Zahnärztinnen und Zahnärzten,
ihre Gewohnheiten beizubehalten und gleichzeitig das Arzt-Patienten-Verhältnis zu verbessern.
Mit künstlicher Intelligenz kann die Zahnmedizin durch einen vereinfachten Arbeitsablauf um ein einzigartiges Patientenerlebnis
erweitert werden. Allisone ermöglicht es Zahnärztinnen und Zahnärzten, ihre Patientinnen
Allisone represents the best of human and artificial intelligence (AI). Allisone is a software as
a service, or SaaS, app and uses AI technologies,
including deep learning and computer vision, to
highlight elements on dental radiographs such as
past treatments and radiolucencies.
Allisone has a simple and intuitive interface
that helps dentists explain radiographs to their
patients by means of a colour code. The main
purpose of this functionality is to support the
clinician’s explanation visually, so that the patient can visualise and understand the state of
his or her oral health.
Patient comprehension and chairside education are key to treatment plan adherence. By
highlighting the elements on the radiograph,
and thanks to Allisone’s treatment illustrations, the clinician is in a position to quickly explain the treatment
plan and easily address the patient’s
questions. The patient can therefore
easily visualise the clinician’s explanation and understand more easily the
potential benefits and risks of the proposed care. This clarity helps the dental professional to become fully involved in the treatment plan and
significantly increases patient trust.
The intuitiveness of Allisone allows dentists to improve efficiency in
their daily practice. It helps them to
create an ideal treatment plan with
just a few clicks and then print and
send the report and related information to the patient. The educational
sheets provided help the patient to understand and visualise what has been
diagnosed, and illustrations of the care
and treatment outcome enable the patient to understand the treatment proposed.
The digitisation of the patient file
helps to simplify collaboration and
data transmission within the practice
as well as between devices and clinicians. This means that the practitioner
increases efficiency in the clinic and improves
the patient experience.
By design, Allisone works in conjunction
with the radiographic software and can be integrated into a large number of patient management software programs. Interoperability allows dentists to maintain their own routines
while improving the practitioner–patient relationship.
With AI, dentistry can be enhanced by the
provision of a unique patient experience and a
simplified workflow. Allisone enables dentists
to include their patients in their treatment, and
this helps to increase treatment adherence.
Visit Allisone at IDS 2023 for a free demo and
special offers.
Allisone, France
www.allisone.ai
Hall 11.1, Booth G050
MEGAGEN’S ANYRIDGE—NEW GLOBAL STANDARD FOR IMPLANT DESIGN
As the name suggests, the MegaGen’s
AnyRidge implant system can be
used for any implant case. However,
clinical results show that its benefits
are particularly significant in cases
with immediate or early loading—
even in situations with compromised
bone density.
AnyRidge allows dentists to offer
patients new smiles faster than ever.
It facilitates the preservation of cortical bone, promotes strong osseointe-
AnyRidge.
gration faster, permits stability from
the start and offers an incredible implant–prosthetic connection with a
fantastic soft-tissue response.
Despite the growing body of clinical evidence demonstrating the benefits of the AnyRidge implant system
for both dentists and patients, some
clinicians may still be reluctant to use
it, owing to their habit of using other
implants and standard techniques.
That is why MegaGen has introduced
BLUEDIAMOND
IMPLANT.
the latest member of the AnyRidge
family: BLUEDIAMOND IMPLANT.
Though it has a slightly different
implant body shape and connection,
BLUEDIAMOND IMPLANT still incorporates many of the key features of
AnyRidge. It offers a simple solution
for clinicians wishing to offer the best
to their patients without significantly
changing their surgical protocols.
BLUEDIAMOND IMPLANT is made of
pure medical-grade titanium that is
backed by more than 20 years of clinical evidence demonstrating its biocompatibility. It is designed to create
less bone stress and, by offering a
200% increase in compressive
strength, prioritises the implant’s
long-term mechanical stability.
BLUEDIAMOND IMPLANT’s unique
KnifeThread design allows for superior initial stability in situations with
compromised bone. Combined with
different thread depth options, this
enables easy implant placement with
good primary stability in all bone densities. BLUEDIAMOND IMPLANT is
also available in various fixture diameters for all tooth sizes, enabling it to
be placed even in larger osteotomy
sockets.
Devised from architectural principles, the arch-type keystone that
forms BLUEDIAMOND IMPLANT’s
X-FIT connection improves long-term
mechanical stability while delivering
high levels of resistance to external
compressive forces, such as mastication, by excellently dispersing stress.
Furthermore, the abutment can
be precisely rotated in 45° increments, allowing for accurate positioning, particularly when using an angled abutment. In this way, it reduces
unnecessary chair time through a
prosthetic design that minimises
screw loosening.
Available in a variety of sizes, the
AnyRidge prosthetic line-up satisfies
all clinical needs, such as overden-
tures, all-on-four, digital prostheses
and general prostheses. To secure the
aesthetic results needed for implants
in the anterior zone, the RC-BASE
abutment has been made available
as a prosthetic component in the
AnyRidge implant system.
The RC-BASE possesses an angled tool channel, which allows for
the position of the screw access
hole in the anterior zone to be
changed if necessary. Its innovative
double-pitch screw is designed to
minimise sinking down by employing the screw’s thread as a stopper,
which also prevents screw loosening and the cold-welding phenomenon that can occur between fixture
and abutment.
MegaGen Implant,
South Korea
www.imegagen.com
Hall 4.2, Booth K070
[69] =>
untitled
[70] =>
untitled
industry
70
AG.LIVE: DIE GRUNDLAGE FÜR DEN PERFEKTEN DIGITALEN WORKFLOW AG.LIVE: THE BASIS FOR THE PERFECT DIGITAL WORKFLOW
Die Cloud-Plattform AG.Live verbindet nicht
nur Dentalpraxen und -labore, sondern auch
die Maschinen, Prozesse und Systeme von
Amann Girrbach untereinander. „Die Möglichkeiten, die sich dank AG.Live ergeben sind
sensationell. AG.Live vereinfacht die Zusammenarbeit zwischen den Praxen und den Laboren, aber auch zwischen uns und unseren
Kunden, auf eine noch nie dagewesene Weise.
Es war noch nie so einfach, per Knopfdruck
auf jeden Patientenfall individuell zugeschnittene Tipps zu erhalten oder per Mausklick
Unterstützung durch unseren Service in Anspruch zu nehmen“, erklärt Christian Ermer,
Vice President Marketing & Digital bei Amann
Girrbach.
Mit AG.Live werden Patientenfälle unter
Einhaltung der EU- und US-Datenschutzgesetze zentral verwaltet und sind für das
Labor- und Zahnarztteam zugänglich. Die
Abstimmungen untereinander werden damit
wesentlich einfacher. So können sich beispielsweise bei Fall-Besonderheiten die involvierten Anwender direkt in der Plattform miteinander austauschen. Ermer erklärt weiterhin, dass AG.Live das Aufteilen oder Auslagern der Arbeiten vereinfacht: „Über unsere
Ceramill-Design-Software kann beispielsweise das Design einer Restauration vom
zahntechnischen Labor ausgeführt und in
Folge vom Zahnarzt direkt übernommen werden.“
AG.Live bietet einen 100-prozentig integrierten, nahtlosen Arbeitsablauf von A bis Z
und bringt neben großer Zeit- und Kostenersparnis vor allem einen sicheren, validierten
Workflow. „Wichtig ist uns dabei auch, den
Anwendern die Möglichkeit zu geben, Drittprodukte einbinden zu können – wie beispielsweise Intraoralscanner-Daten anderer Hersteller. AG.Live bietet für die Beauftragung, wie
die Erstellung des Designs der Restauration
bis hin zur Beauftragung der kompletten Fertigung somit alle Vorteile eines offenen Workflows. Gleichzeitig bietet AG.Live maximale
Sicherheit dank unserer umfassenden Prozessvalidierung“, so Ermer.
Vom Materialmanagement, über Software-Updates bis zum Support-Ticket – die Anbindung der Ceramill-Maschinen an AG.Live
bringt eine Reihe an Vorzügen und bietet Erleichterungen bei der Wartung oder im Service. Durch die Verbindung von AG.Live mit
den Maschinen von Amann Girrbach wird es
künftig möglich sein, von überall und jederzeit ein Update zum Status der Maschinen sowie zu den abgearbeiteten Aufträgen zu bekommen. Informationen, Warnungen oder
Fehler werden dann direkt in AG.Live oder auf
Wunsch per SMS auf ein hinterlegtes Smartphone gemeldet. „Diese Meldungen sind ein
Feature, das vor allem auch beim automatisierten Arbeiten der Maschinen mehr Freiheit
und Sicherheit verschafft – und zwar egal, wo
sich der Anwender gerade befindet“, unterstreicht Ermer. Der Zugriff auf AG.Live kann
von jedem internetfähigen Gerät aus erfolgen.
Auch Software-Updates und die vielfältigen
Inhalte der Software-Bibliothek von Amann
Girrbach sind in AG.Live eingebunden und
damit einfach zugänglich.
Gerne informieren wir Sie auf unserem
IDS-Stand persönlich zu AG.Live. Vor Ort haben Sie die Möglichkeit, den kompletten digitalen dentalen Workflow live zu erleben und
sich damit selbst ein Bild der vielen Vorteile
zu machen. Amann Girrbach bietet außerdem
täglich Vorträge zu verschiedenen Themen
am Stand an.
The AG.Live cloud platform not only connects
dentists with dental technicians, but also connects Amann Girrbach’s machines, processes
and systems with each other. Christian Ermer,
vice president for marketing and digital products at Amann Girrbach, said: “The potential
offered by AG.Live is sensational. It simplifies
collaboration in an unprecedented manner between practices and laboratories, but also between us and our customers. It has never been
easier, with the touch of a button, to receive advice that is tailored to each individual case or,
with the click of a mouse, to access our support
service.”
With AG.Live, patient cases are managed
centrally in compliance with EU and US data
protection laws and can be accessed by the laboratory and dental teams. This makes coordination far easier. For example, in the case of special circumstances or anomalies, the users
involved can exchange information and files directly using the platform. Rütten explains that
AG.Live also simplifies splitting or outsourcing
work: “The design of a restoration can be performed by the dental laboratory via our Ceramill
design software and subsequently taken over
directly by the dentist.”
AG.Live offers a 100% integrated, seamless
workflow from A to Z, and in addition to considerable time- and cost-savings, it provides a secure, validated workflow. Rütten said: “It is important for us to give users the option of
integrating third-party products, such as using
data from intra-oral scanners made by other
manufacturers. AG.Live therefore offers all the
advantages of an open workflow for commissioning work, such as creating the design of the
restoration and assigning complete fabrication.
At the same time, it provides maximum security, owing to our comprehensive process validation.”
From material management to software updates and support tickets, connecting Ceramill
machines to AG.Live provides numerous benefits and enables simplification in the areas of machine maintenance and service. In the future,
connecting the two will make it possible to
obtain an update on the status of the machines
as well as the processed orders, from any
location, at any time. Information, warnings
and error messages will then be reported directly in AG.Live or via SMS to a mobile device.
“These messages are a feature that provides additional freedom and safety, especially when the
machines are working in automated mode, no
matter where the user is at the time,” emphasised Rütten. AG.Live can be accessed from any
internet-capable device, and software updates
and the extensive content of the Amann Girrbach
library can also be easily accessed via the platform.
We would be happy to inform you personally about AG.Live at our IDS booth. On-site you
have the opportunity to experience the complete digital dental workflow live and to get an
idea of the many advantages. Amann Girrbach
also offers a daily lecture programme at its
booth.
Amann Girrbach, Austria
www.amanngirrbach.com/ids
Hall 1.2
Booth C040/D041
CHAIRSIDE RESTORATION PLUS MIT ORANGEDENTAL CHAIRSIDE RESTORATION PLUS WITH ORANGEDENTAL
Auf der IDS 2023 präsentiert
orangedental den offenen ChairsideWorkflow für professionelle Praxislabore. Unter dem Motto „Chairside
Restoration plus“ können Besucherinnen und Besucher eine Alternative zu bestehenden Systemen für
die Nass- oder Trockenbearbeitung
von Blöcken und Ronden erleben.
Einfach gesagt: Mit dem intraoralen
Scannen mit dem FUSSEN-Scanner,
dem Design mit exocad ChairsideCAD und der Fertigung mit Dentalfräsmaschinen der EVO deskMill-
1: FUSSEN intra-oral scanner. 2: EVO deskMill5 Pro.
Serie können Zahnärztinnen und
Zahnärzte mehr als nur Kronen
oder Inlays fräsen.
Im Röntgenbereich wird mit
dem Green 2 eine professionelle
DVT-Einheit der Extraklasse mit Field
of View bis zu 10 × 8 cm für Einstei-
ger vorgestellt. Das bekannte Panoramaröntgengerät PaX-i findet mit
dem PaX-i Plus einen Nachfolger in
neuem Design. Das EzRay AIR W2
ist ein neues Intraoral-Röntgengerät
mit Bluetooth-Übertragung der Aufnahmeparameter. Die digitale Funktionsanalyse mit dem neu entwickelten, digitalen Freecorder Nxt und
Schnittstelle zum exocad Jaw Motion
Import-Modul ermöglichen passgenaue Endprodukte unter Berücksichtigung der dynamischen Okklusion.
Besuchen Sie den Stand des Unternehmens, um mehr zu erfahren.
At IDS 2023, orangedental is presenting its open chairside workflow
for professional practice laboratories.
Under the slogan “Chairside Restoration plus”, visitors can experience
the company’s alternatives to existing systems for the wet or dry processing of blocks and discs. Simply
put, with intra-oral scanning using
the FUSSEN scanner, design with
exocad ChairsideCAD and production with dental milling machines
from the EVO deskMill series, dental
professionals can create more than
just mill crowns or inlays.
40th International Dental Show 2023 • 14. März 14 March
Also on show at IDS will be the
company’s innovations in the field of
radiography. Among these is the
Green 2, a first-class professional
entry-level CBCT unit with a field
of view of up to 10 × 8 cm. The wellknown PaX-i dental panoramic tomogram machine has found a successor
in the PaX-i Plus, which features a
new design. The EzRay AIR W2 is a
new intra-oral radiography device
that supports Bluetooth transmission
of the acquisition parameters. The
digital functional analysis that is offered by the newly developed digital
Freecorder Nxt and its interface with
the exocad Jaw Motion Import module
enable dental professionals to create
tailor-made products that account
for dynamic occlusion. Visit the company’s booth to find out more.
orangedental,
Germany
www.orangedental.de
Hall 11.2
Booth L020/N029
[71] =>
untitled
industry
71
FDI FEIERT AM 20. MÄRZ WELTMUNDGESUNDHEITSTAG
FDI TO CELEBRATE WORLD ORAL HEALTH DAY ON 20 MARCH
Jedes Jahr am 20. März feiern Menschen auf
der ganzen Welt den Weltmundgesundheitstag (World Oral Health Day, WOHD), um auf
die immense Belastung durch Mundkrankheiten aufmerksam zu machen. Die dreijährige
Kampagne mit dem Motto „Sei stolz auf deinen
Mund“ geht nun in das letzte Jahr. Schätzungen zufolge sind fast 3,5 Milliarden Menschen
von Munderkrankungen betroffen, die sich
auf ihr Wohlbefinden und ihre Lebensqualität
auswirken. Die WOHD-Kampagne betont,
dass die Gesunderhaltung des Mundes in jedem Alter ein wesentlicher Bestandteil der allgemeinen Gesundheit ist, und ruft daher die
Menschen dazu auf, sich um ihre Mundgesundheit zu kümmern, damit sie ein Leben
lang lächeln können.
Beteiligen Sie sich und feiern Sie den Weltmundgesundheitstag mit Millionen Menschen
auf der ganzen Welt
Der Weltverband der Zahnärzte FDI ist davon überzeugt, dass jeder dazu beitragen kann,
der Belastung durch Mundkrankheiten entgegenzuwirken, indem der WOHD gefeiert wird
und die vorgefertigten und anpassbaren Informationsmaterialien der Kampagne weitergegeben werden, um das Bewusstsein für die
Bedeutung der Mundgesundheit in allen Lebensabschnitten zu schärfen. Unter den Materialien befinden sich Aktions-Toolkits, Informationsblätter, Karten mit den wichtigsten
Botschaften, Anzeigen, individuelle Poster und
Bilder.
Eine weitere Möglichkeit zur Teilnahme
bietet die neu gestartete #MouthProudChallenge,
die Einzelpersonen dazu motiviert, sich der On-
line-Kampagnenbewegung anzuschließen, indem sie das Online-Polaroid-Tool der Kampagne
oder Instagram- und Facebook-Filter nutzen,
um eine Botschaft über ihren Mund und dessen Bedeutung für sie zu teilen.
Denn ein gesunder Mund bedeutet, dass
man die alltäglichen Dinge des Lebens zu
schätzen weiß, wie z. B. eine Mahlzeit zu genießen, sich mit dem Nachbarn zu unterhalten,
mit Familie und Freunden zu lachen, aus Spaß
zu singen, geliebte Menschen zu küssen und
sich wohlzufühlen.
Seien Sie an diesem WOHD stolz auf Ihren
Mund, damit Sie ein Leben lang lächeln können, und inspirieren Sie andere, dasselbe zu
tun.
Weitere Informationen über WOHD, die
Ressourcen der Kampagne, die #MouthProudChallenge und das Online-Polaroid-Tool finden
Sie unter www.worldoralhealthday.org.
Every year on 20 March, people around the
globe unite to celebrate World Oral Health Day
(WOHD) and put the spotlight on the immense
burden caused by oral disease. The campaign is
entering the final year of the three-year “Be
proud of your mouth” theme. It is estimated that
oral disease affects nearly 3.5 billion people,
having an impact on their well-being and quality of life. The WOHD campaign emphasises
that maintaining a healthy mouth at all ages is
an essential part of overall health, and therefore, it calls upon people to look after their oral
health for a lifetime of smiles.
Get involved and celebrate World Oral
Health Day with millions across the world.
FDI believes everyone can help address the
oral disease burden by celebrating WOHD and
sharing the campaign’s ready-made and customisable resources, including action toolkits, fact
sheets, key message cards, advertisements, custom posters and frames, in order to raise awareness of the importance of taking care of oral
health at all stages of life.
Another way to participate is to take part in
the newly started #MouthProud challenge, which
motivates individuals to join the online campaign movement by utilising the campaign’s online polaroid tool or Instagram and Facebook filters in order to share a message about their
mouth and what it means to them.
After all, a healthy mouth means being able
to appreciate everyday aspects of life, such as
enjoying a meal, talking to a neighbour, laughing
with family and friends, singing for fun, kissing
loved ones and feeling great.
This WOHD, be proud of your mouth for a
lifetime of smiles, and inspire others to do the
same.
More information on WOHD, the campaign’s
resources, the #MouthProud challenge and
the online polaroid tool can be found at www.
worldoralhealthday.org.
FDI World Dental Federation,
Switzerland
www.fdiworlddental.org
Hall 11.2, Booth N069
AD
HurriView® and HurriView II® highlight where improved oral hygiene is needed
Available in 1 fl. oz. bottles of liquid, 1 oz. bottles of gel and
individually wrapped unit dose Snap -n- Go™ Swabs
20% Benzocaine for fast, temporary relief of
occasional minor irritation and pain associated with:
• Sore mouth and throat
• Canker sores
• Minor dental procedures
• Minor injury of the mouth and gums
• Minor irritation of the mouth and gums caused by
dentures or orthodontic appliances
EFFECTIVE
• Trusted by dental professionals for over 40 years
• Eliminates pain and discomfort
FAST-ACTING
• Relief within 30 seconds
SAFE
• Virtually no systemic absorption
• Available over the counter
• HurriView highlights plaque in reddish-pink
• HurriView II highlights old plaque in blue and
new plaque in reddish-pink
• Helps you show patients where they have
plaque build-up & helps motivate them to
improve their oral hygiene routines
• Individually wrapped
• In-office evaluation or dispense for home use
• Available in boxes of 72
• No messy rinses or tablets!
FAST-ACTING
Chairside results
TREATS SENSITIVITY
When used for cervical sensitivity,
HurriSeal® will last for 6 to 9 months
PREVENTS SENSITIVITY
When applied under restorations, HurriSeal
lasts for the lifetime of the restoration
EASY TO USE
No mixing or light-curing
SOFT TISSUE FRIENDLY
Gentle to soft tissue and does not cause
gingival irritation when used as directed
40th International Dental Show 2023 • 14. März 14 March
[72] =>
untitled
industry
72
NEUE TECHNOLOGIEN UND HYGIENEKONZEPTE AN STÄNDEN VON BLUE SAFETY UND DENTAL.SHOP
Der Dentalmarkt ist im Umbruch – viele bekannte Wasserdesinfektionsmittel haben unter der Biozidverordnung ihre Verkehrsfähigkeit verloren. Jetzt braucht es neuartige Systeme und ein ausgefeiltes Konzept, um langfristige finanzielle und gesundheitliche Folgeschäden zu verhindern.
Unbemerkt können sich über das Jahr
Keime in die Trinkwasserinstallationen einschleichen. Unbemerkt kam es aber auch zu
einer Veränderung der regulatorischen Vorgaben für deutsche Zahnarztpraxen. Was bisher
noch erlaubt war, stellt heute eine wichtige Veränderung zu den Fragen der Wasserhygiene
dar. Denn viele Wasserdesinfektionsmittel für
Dentaleinheiten auf Basis von Wasserstoffperoxid oder Biguanidin haben ihre Verkehrsfähig-
keit verloren. Umso schwieriger wird es, den
geltenden Hygieneanforderungen so noch gerecht zu werden. Denn natürlich bilden sich in
den Wasser führenden Leitungen auch weiterhin aquatische Biofilme. Besonders ärgerlich
wird es, wenn die Ablagerungen bis in die Instrumente reichen und diese verstopfen oder
sogar Dentaleinheiten langsam zersetzen – horrende Reparaturkosten sind die Folge. Auch
das gesundheitliche Risiko sollte nicht unterschätzt werden. Neben Kolibakterien und Pseudomonas aeruginosa gefährdet insbesondere
Legionella pneumophila die Gesundheit. Über
Aerosole gelangen die Legionellen in die Atemwege und können schwere Lungeninfektionen
auslösen. Ein hohes Gefahrenpotenzial für Patientinnen und Patienten sowie das Praxisteam.
Zugelassene und kontinuierliche
Trinkwasserdesinfektion
für dauerhaften Erfolg
Die neueste SAFEWATER-Technologie basiert auf einer kontinuierlichen Trinkwasserdesinfektion und ist zur Desinfektion von Wasser auch in dentalen Behandlungseinheiten
unter der aktuellen Biozidverordnung zugelassen. Statt erst bei gravierenden Problemen
wie mikrobiellen Kontaminationen zu handeln, sorgt die zentral implementierte Anlage
präventiv für eine effektive Desinfektion und
verhindert die Neubildung von Biofilm. Der
umfangreiche Full-Service sorgt zudem für Entlastung im Praxisalltag.
Die SAFEBOTTLE ist das erste hygienisch –
validiert gemäß DIN EN ISO 17664 – aufbereit-
bare Druckflaschensystem seiner Art made in
Germany und setzt damit neue Maßstäbe. Die
SAFEBOTTLE ist die hygienische Alternative
für mit Pilzen befallene freie Fallstrecken und
Mischkammern in Dentaleinheiten, die einer
Kreuzkontamination von Aerosolen aus der
Absauganlage im Stuhl ausgesetzt sind. Hochwertigste Materialien und ein intelligenter Aufbau sorgen außerdem für einen hohen Hygienestandard und eine lange Lebensdauer.
Dank neugewonnener Arbeitssicherheit können Sie sich besser auf Ihre eigentliche Tätigkeit konzentrieren.
Neue Hygienekonzepte von
DENTAL.SHOP
Wer seine Desinfektionsmittel in Zukunft
lieber selbst herstellen will, ist bei DENTAL.
SHOP bestens aufgehoben. Innovative Qualitätsmanagement-Bausteine ermöglichen die RKIkonforme Desinfektion von Absauganlagen für
mehr Umweltschutz.
Wasserhygiene endlich
sichtbar machen
Wie Sie mit dem Einsatz der SAFEWATERHygienetechnologie und SAFEBOTTLE Patientinnen und Patienten für Ihr Praxisunternehmen gewinnen, zeigen Ihnen die Wasserexperten des Medizinprodukteherstellers BLUE
SAFETY auf der IDS. Neben der Beratung locken limitierte Sammeltassen. Ein Besuch lohnt
sich!
BLUE SAFETY, Germany
www.bluesafety.com
Hall 2.2
Booth A030/B049
Neue Technologien und Hygienekonzepte erwarten Sie am gemeinsamen Stand von BLUE SAFETY und DENTAL.SHOP.
NEUE 3D-DRUCKTECHNOLOGIE UND HOCHWERTIGE MATERIALIEN VON DESKTOP HEALTH
NEW 3D-PRINTING TECHNOLOGY AND PREMIUM MATERIALS FROM DESKTOP HEALTH
Falls Sie die Neuigkeit verpasst
haben: EnvisionTEC, Pionier der DLPDrucktechnologie, heißt jetzt Desktop Health. Mit mehr als 20 Jahren
Erfahrung im deutschen Maschinenbau bietet Desktop Health hochwertige 3D-Drucklösungen für die
Zahnmedizin, welche eine individuelle Patientenversorgung mit präziser Passform und Verarbeitung ermöglichen.
Desktop Health hat kürzlich
eine innovative neue Drucktechnologie und hochwertige Materialien auf den Markt gebracht. Wir
laden Sie ein, unseren Stand auf der
IDS zu besuchen, um mehr über die
Vorteile unserer Lösungen für Ihr
Unternehmen zu erfahren.
Die Produkte von Desktop
Health, wie der neue Einstein Pro XL
Hochpräzisions-DLP-Drucker, der
für maximale Produktivität ausgelegt wurde und dessen Fokus auf
Geschwindigkeit liegt, sind perfekt
auf die Bedürfnisse von zahnmedizinischen Teams zugeschnitten
und erfüllen die wichtigsten Anforderungen des 3D-Drucks im Dentalbereich. Darüber hinaus er möglichen die hochwertigen biokompatiblen Materialien und Modellmaterialien des Unternehmens
höchste Genauigkeit, Durchsatz und
Vielseitigkeit.
Die neuen SmileGuard Aufbissschienen aus Kunststoff bieten die
perfekte Mischung aus Festigkeit
und Komfort zum Schutz des Lächelns Ihrer Patienten. Der FlexceraZahnersatz bietet keramikähnliche
Festigkeit und Ästhetik mit einer
dreifach höheren Bruchdehnung
für Langlebigkeit und einer doppelt so hohen Beständigkeit gegen
Feuchtigkeit im Vergleich zu führenden Wettbewerbern. Die Materialien des Modells X bieten eine
überragende Präzision für Kronen
und Brücken, und das Modell Z ermöglicht die schnelle Herstellung
von kieferorthopädischen Vollbögen.
Erfahren Sie mehr über unsere
fortschrittlichen Dentalmaterialien
und erleben Sie unsere außergewöhnlichen Endergebnisse sowie die
vier einfachen Schritte des digitalen
3D-Druck-Workflows und die perfekte Passform, die Desktop HealthLösungen Ihrem Unternehmen bieten können.
Unsere Experten für den dentalen 3D-Druck stehen Ihnen während der gesamten Messe zur Verfügung, um die richtigen Lösungen für
Sie zu finden. Gemeinsam können
wir Ihr Unternehmen in ein produktives, zuverlässiges und kosteneffizientes Geschäft verwandeln.
In case you missed the news:
EnvisionTEC, the pioneer in digital
light-processing (DLP) technology,
has undergone a transformation and
is now known as Desktop Health. With
over 20 years of German engineering
experience, Desktop Health offers
high-quality and affordable dental
3D-printing solutions that deliver
personalised patient care with a precision fit and finish.
Desktop Health has recently
launched an innovative new printing
technology and premium materials.
We invite you to visit our booth at IDS
to learn more about the benefits of
our solutions for your business.
Perfectly designed for dental professionals to meet the most crucial
needs in dental 3D printing, Desktop
Health products, such as the new
Einstein Pro XL high-precision DLP
printer, which was built for production-grade performance and speed. In
addition, the company’s premium biocompatible model materials allow for
highest accuracy, throughput and
versatility.
The new SmileGuard resin bite
splints offer the perfect blend of
strength and comfort to protect your
patient smiles. Flexcera dentures offer ceramic-like strength and beauty
with three times the fracture rate for
durability and two times the resist-
ance to moisture compared to leading
competitors. Model X materials deliver superior accuracy for crown and
bridges, and Model Z delivers speed
for producing orthodontic full arches.
Learn about our advanced dental
resins and experience our exceptional end results as well as the four
easy steps of digital 3D-printing workflow and the perfect fit Desktop
Health solutions can provide your organisation.
40th International Dental Show 2023 • 14. März 14 March
Our dental 3D-printing experts
are available throughout the exhibition to help you identify the right
solutions for your business needs. Together we can transform your business into a productive, reliable and
cost-efficient work environment.
Desktop Health, USA
health.desktopmetal.com
Hall 4.1, Booth D070
[73] =>
untitled
V½ÄÞêÚ¤Ú¬ÞÞ¬½ü
5HVHUYHIURP\RXUVWRFNGLJLWDOO\
2UGHUPLVVLQJLPSODQWVSULRU
WRRSHUDWLRQRQOLQH
%˽½Ëöê×û׬ڬĤ
¬Ã×½ÄæÞ
.HHSVWUDFNRIWKHH[SLU\GDWHVVRWKDW\RX
FDQXVHWKHPEHIRUHLW¶VWRRODWHRURഔHUIRU
VDOHRUH[FKDQJH
ËÄæÚ˽ÄÃËĬæËÚüËêÚ
¬Ã×½ÄæÞæ˺£ÚËÃ
Äüö©ÚæÄüæ¬Ã
(QMR\\RXUKROLGD\VZHHNHQGVGLQQHUVWLPHZLWK
IDPLO\1RPRUHVOHHSOHVVQLJKWVEHFDXVHRI23
SODQQLQJ
[74] =>
untitled
industry
74
Guided Biofilm Therapy – ein Erfolgskonzept in der Prophylaxe und
Erhaltungstherapie Guided Biofilm Therapy—a successful concept in
prevention and maintenance therapy
turbing and reflected the findings of
the German consumer organisation
Stiftung Warentest―50% of biofilm was
not removed from inaccessible areas.1
What does GBT mean?
The modular and evidence-based
eight-step GBT protocol is a systematic
solution for biofilm management in
professional mechanical plaque removal and supportive periodontal and
implant therapy. Painless treatment
that is gentle on teeth and tissues is
possible using AIRFLOW, PERIOFLOW
and PIEZON PS technologies. This allows for need-based and risk-oriented
treatment for patients at all ages. SDA
offers GBT practice trainings to educate dental professionals on the GBT
concept.
Which types of powder do you work
with according to the GBT method?
I work 100% with the erythritolbased AIRFLOW PLUS powder with a
particle size of 14 μ m and have achieved
excellent results with it for years. For
me, the PLUS powder is the powder for
the supra- as well as subgingival removal of biofilm, discolouration and
slightly mineralised biofilm.
Dentalhygienikerin Eva Hochmann arbeitet seit vielen Jahren nach dem Konzept der Guided Biofi lm Therapy. Dental hygienist Eva Hochmann has used the Guided Biofi lm Therapy concept for several
years.
Die Guided Biofilm Therapy (GBT)
ist der Gamechanger in der Prophylaxe. Im Interview spricht Dentalhygienikerin Eva Hochmann, die auch
Dental-Coach und GBT-Trainerin der
Swiss Dental Academy (SDA) ist, über
ihre Erfahrungen mit dem systematischen Konzept.
Frau Hochmann, Sie sind seit 30 Jahren in Zahnarzt-, MKG- sowie oralchirurgischen Praxen tätig. Wann
und warum haben Sie begonnen nach
der GBT zu arbeiten und mit welchen
Hürden waren Sie konfrontiert?
In meiner ersten Weiterbildungsetappe zur zahnmedizinischen Fachassistentin wurde gelehrt, dass Biofilm
nur bei Kindern und PAR-Patienten
im Zusammenhang mit der häuslichen Mundhygieneberatung angefärbt
wird. Anfärben bei Erwachsenen war
für mich lange Zeit negativ belegt.
Die Patienten fühlten sich vorgeführt, wollten die Praxis nicht mit
Restfarbe im Mund verlassen. 2018
kam ich erstmals mit der GBT in Berührung. Da habe ich verstanden,
dass die Visualisierung des Biofilms
nicht nur für den Patienten wichtig
ist, sondern vielfältige Vorteile bietet,
auch für mich als Behandler. Im ersten Moment fiel es mir schwer, einzugestehen, dass ich eventuell über
20 Jahre lang nicht so gearbeitet
habe, wie ich es hätte tun können.
Also ging ich in den Selbstversuch:
Ich färbte die Zähne eines Teils meiner Patienten vor und nach der Behandlung halbseitig an. Das Resultat
war erschreckend und spiegelt auch
die Ergebnisse von Stiftung Waren-
test wider. An schwer zugänglichen
Stellen wurden 50 Prozent des Biofilms nicht entfernt.1
und minimalinvasiven Technologien
ist effizient, zeitsparend, wirtschaftlich und gelenkschonend.2–6
Was bedeutet GBT?
Das modulare und evidenzbasierte Acht-Schritte-Protokoll GBT ist
eine systematische Lösung für das
Biofilmmanagement im Rahmen der
professionellen Zahnreinigung sowie
in der unterstützenden Parodontitistherapie und postimplantologischen
Therapie. Unter Anwendung der AIRFLOW-, PERIOFLOW- und PIEZON PSTechnologien ist eine schmerzfreie,
zahn- sowie gewebeschonende Behandlung möglich. Damit eröffnet
sich für Patienten aller Altersklassen
eine bedarfsgerechte und risikoorientierte Behandlung. Die SDA bietet
Praxistrainings zum Erlernen des
GBT-Konzepts an.
Guided Biofilm Therapy (GBT) is
a game changer in prophylaxis. In
this interview, dental hygienist Eva
Hochmann, who is also a dental coach
and GBT trainer at the Swiss Dental
Academy (SDA) talks about her experiences with the systematic concept.
Ms Hochmann, you have been working in dental, maxillofacial and oral
surgery practices for 30 years. When
and why did you start working according to the GBT concept and what
were the hurdles you faced?
In my first stage of training to become a specialist dental assistant, I
was taught that biofilm is only disclosed
in children and periodontal patients in
connection with home oral hygiene
counselling. For a long time, disclosure in adults had a negative connotation for me. Patients felt they were being humiliated and did not want to
leave the practice with residual colour
in their mouths. In 2018, I encountered
the GBT method for the first time. That
was when I understood that visualising
biofilm is not only important for the
patient but offers multiple advantages
for me as a practitioner too. At first, it
was hard for me to admit that I may
not have worked the way I could have
for over 20 years. I started a self-experiment: I disclosed one half of the teeth of
some of my patients before and after
treatment. The result was quite dis-
Mit welchen Pulverarten arbeiten Sie
nach der GBT-Methode?
Ich arbeite zu 100 Prozent mit
dem AIRFLOW PLUS-Pulver auf Erythritol-Basis mit einer Partikelgröße
von 14 μm und erziele damit seit Jahren beste Resultate. Das PLUS-Pulver
ist für mich das Pulver zur supra- und
subgingivalen Entfernung von Biofilm, Verfärbungen und schwach mineralisiertem Biofilm.
Was ist für Sie persönlich die GBT?
Für mich ist GBT nicht nur ein
Behandlungskonzept, sondern eine
Philosophie. Das Konzept ist eine angenehme und schonende Art, meine
Patienten präventiv zu behandeln.
Das Arbeiten mit diesen modernen
40th International Dental Show 2023 • 14. März 14 March
What does GBT mean for you personally?
For me, GBT is not just a treatment concept; it is a philosophy. The
concept is a pleasant and gentle way
of treating my patients preventively.
Working with these modern and minimally invasive technologies is efficient, time-saving, cost-effective and
gentle on the joints.2–6
Literature
EMS Electro Medical
Systems, Switzerland
www.ems-dental.com
Hall 11.2
Booth L010/M019
[75] =>
untitled
register at www.roots-summit.com
ROOTS SUMMIT IS
COMING TO ATHENS
THE GLOBAL DENTAL CE COMMUNITY
;YPI\UL.YV\W.TI/PZHU(+(*,979LJVNUPaLK7YV]PKLY(+(*,97PZHZLY]PJLVM[OL(TLYPJHU+LU[HS(ZZVJPH[PVU[VHZZPZ[KLU[HSWYVMLZZPVUHSZPUPKLU[PM`PUNX\HSP[`WYV]PKLYZVMJVU[PU\PUNKLU[HSLK\JH[PVU(+(*,97KVLZUV[HWWYV]LVY
LUKVYZLPUKP]PK\HSJV\YZLZVYPUZ[Y\J[VYZUVYKVLZP[PTWS`HJJLW[HUJLVMJYLKP[OV\YZI`IVHYKZVMKLU[PZ[Y`;YPI\UL.YV\W.TI/KLZPNUH[LZ[OPZHJ[P]P[`MVY18.5 continuing education credits;OPZJVU[PU\PUNLK\JH[PVUHJ[P]P[`OHZILLUWSHUULK
HUKPTWSLTLU[LKPUHJJVYKHUJL^P[O[OLZ[HUKHYKZVM[OL(+(*VU[PU\PUN,K\JH[PVU9LJVNUP[PVU7YVNYHT(+(*,97[OYV\NOQVPU[LMMVY[ZIL[^LLU;YPI\UL.YV\W.TI/HUK+LU[HS;YPI\UL0U[LYUH[PVUHS.TI/
[76] =>
untitled
industry
76
GESUNDE ZÄHNE, GLÜCKLICHER MENSCH:
CURADEN – BETTER HEALTH FOR YOU HEALTHY TEETH, HAPPY
PERSON: CURADEN—BETTER HEALTH FOR YOU
Curaden gilt als eines der weltweit führenden Unternehmen für ganzheitliche orale Gesundheitskonzepte. Seit mehr als 65 Jahren
produziert und vertreibt das Schweizer Unternehmen diverse Produktlinien für Zahn- und
Mundpflege. Das Besondere ist das ganzheitliche Konzept von Curaden, das bei der Prävention ansetzt.
Gute Mundgesundheit wirkt sich positiv
auf den Allgemeinzustand eines Menschen
aus – daher das Versprechen „better health
for you“. Mit heiteren Farben und bisweilen
außergewöhnlichen Aromen verhelfen wohldurchdachte Produkte zu einer guten und
nachhaltigen Mundgesundheit.
AD
Ausgewiesene und erfahrene Fachpersonen sind an der Produkentwicklung maßgeblich beteiligt. Die Produktpalette von Curaden
beinhaltet Schallzahnbürsten, Handzahnbürsten, Interdentalbürsten, Zahnpasten und
Mundspülungen sowie Beißringe und Schnuller.
Swissness – fast alle Produkte werden
ausschließlich in der Schweiz entwickelt, geprüft und hergestellt.
Produkte fürs Leben
CURAPROX-Produkte von Curaden begleiten Menschen ein Leben lang. Noch bevor der
erste Zahn durchbricht, lindern biofunktio-
nelle Beißringe und Schnuller Zahnungsbeschwerden.
Sind die Zähne da, so passen
die Zahnbürsten in diversen
Ausführungen und Bürstenkopfgrößen in alle kleinen
und großen Hände. Auch bei
kieferorthopädischen Behandlungen oder chirurgischen Eingriffen können die
ausgeklügelten Produkte von
Curaden eine gesunde, nachhaltige Mund- und Zahnpflege unterstützen. Produkte in stylishen Farben,
neuen Formen und mit innovativen Aromen fördern die
Selbstverständlichkeit der
Mundhygiene.
Curaden is one of the global leaders for comprehensive oral health concepts. For over
65 years, the Swiss company has produced and
distributed a wide range of different oral care
products. What sets Curaden apart is its holistic
approach, which is based on prevention.
Good oral health has a positive effect on a
person’s overall health―hence, the Curaden
promise “better health for you”. With bright
colours and extraordinary flavours, Curaden’s
products contribute to long-lasting oral health.
Qualified and experienced specialists play
a key role in the product development process.
The product range includes sonic toothbrushes,
manual toothbrushes, interdental brushes,
toothpastes and mouthwashes as well as teething rings and soothers.
Swissness―almost all products are exclusively developed, tested and manufactured in
Switzerland.
Products for life
CURAPROX products from Curaden accompany people throughout their lives. Even
before the first tooth erupts, biofunctional
teething rings and soothers help relieve pain.
Once the teeth have erupted, toothbrushes
with various designs and brush heads allow
children and adults to maintain good oral hygiene. Furthermore, Curaden’s sophisticated
products support healthy and sustainable
oral care during orthodontic or implant treatment. Products in stylish colours, exciting
shapes and innovative flavours pomote oral
hygiene in everyday life.
Curaden, Germany
www.curaden.de
Hall 5.2
Booth D051
[77] =>
untitled
www.zwp-online.info
Seid ihr auch
?
#ADDICTED
Wir sind es!
Nach News, News und
noch mehr News!
OEMUS MEDIA AG
Holbeinstraße 29 · 04229 Leipzig · Deutschland
Tel.: +49 341 48474-0 · info@oemus-media.de
[78] =>
untitled
service
78
Was ist sonst noch los in Köln?
What’s on in Cologne?
Belgisches Viertel
• Wo: Brüsseler Platz, Köln
Kölns Belgisches Viertel ist an jedem Abend der Woche ein gutes
Ausflugsziel. Dort kommen Besucherinnen und Besucher sowie Einheimische zusammen, um Kölns
kulinarische Vielfalt zu entdecken,
einzukaufen oder in einer Bar zu
entspannen. Rund um den Brüsseler
Platz, wo die neoromanische Kirche
St. Michael steht, gibt es unzählige
Boutiquen, Theater, Cafés, Bars und
Restaurants. Wenn Sie es tagsüber
hierher schaffen, halten Sie Ausschau nach cafecafe, einem kleinen,
trendigen Café mit bunt gestreiftem
Interieur, warmen und kalten Kaffeespezialitäten und einem köstlichen Mittagsmenü. Wer auf der Suche nach einem zweiten Zuhause
ist, sollte abends bei der Wohngemeinschaft vorbeischauen, die CaféBar, Theater und Hostel zugleich ist.
Ein Drink auf einem Retro-Barhocker
in diesem freundlichen Lokal ist
vielleicht genau das Richtige!
Kölner Schokoladenmuseum
• Wann: Täglich, 10:00–18:00 Uhr
• Wo: Am Schokoladenmuseum 1a,
50678 Köln
• Informationen:
www.schokoladenmuseum.de
Schranke (Pommes mit Mayonnaise
und Ketchup) sehr zu empfehlen.
Seien wir ehrlich: Obwohl wir
versuchen, unsere Zähne gut zu pflegen, gehört Schokolade zu den Versuchungen, denen man nur schwer widerstehen kann. Wer es ins berühmte
Kölner Schokoladenmuseum schafft,
wird es nicht bereuen. Ebenso ist der
Geschenkeladen ein Muss.
Kölner Kinogenuss
Frittenwerk
• Wann: Montag–Donnerstag,
11:30–22:00 Uhr
Freitag und Samstag
11:30–23:00 Uhr
• Wo: Ehrenstraße 94, 50672 Köln
• Informationen:
www.frittenwerk.com/koeln.php
Manchmal gibt es einfach nichts
Besseres als eine Portion selbstgemachte Pommes, vor allem eine, die
mit frisch zubereiteten Toppings serviert wird. Käsesauce und Schnittlauch oder Guacamole gefällig? Ein
kalorienreicher Tipp: Die kanadische
Spezialität Poutine (Pommes mit
Soße und Käse) wird die Herzen ahnungsloser Zahnärztinnen und Zahnärzte im Sturm erobern. Für Puristen ist auch der Klassiker Pommes
• Wann: Täglich, bitte erkundigen
Sie sich im Voraus über Details.
• Informationen: www.kino.de/
kinoprogramm/stadt/koeln
Was gibt es Schöneres nach einem anstrengenden Messetag als gedimmtes Licht, einen bequemen Kinosessel und eine große Portion
Popcorn? Filmisch hat Köln viel zu
bieten, und Besucherinnen und Besucher der Stadt können sich an jedem Abend der Woche an Filmen
sattsehen. Für Arthouse-Liebhaberinnen und -Liebhaber ist die Stadt
ein Traum. Halten Sie Ausschau nach
Filmforum NRW im Museum Ludwig, Filmpalette, Odeon und Off
Broadway.
Belgian Quarter
• Where: Brüsseler Platz (Brussels
square), Cologne
Cologne’s Belgian Quarter is a good
destination on any night of the week.
There, visitors and locals come together to discover Cologne’s culinary
diversity, to go shopping or to relax in
a bar. Around Brussels square, where
the neo-Romanesque church of St Michael stands, there are countless boutiques, theatres, cafes, bars and restaurants. If you make it here during
the day, keep an eye out for cafecafe,
a small, trendy cafe with a colourfully
striped interior, hot and cold coffee
specialities, and a mouth-watering
lunch menu. In the evenings, those
who are looking for a home away
from home might consider dropping
by die Wohngemeinschaft. Its name
means “shared flat”, and the café-bar,
theatre and hostel is arranged according to the whims of its four fictitious
housemates. A drink while sitting on
a retro bar-stool in this friendly establishment may be just the ticket!
Friday and Saturday,
11:30–23:00
• Where: Ehrenstraße 94,
50672 Cologne
• Information:
www.frittenwerk.com/koeln.php
Sometimes, there is simply nothing
better than a portion of home-made
fries, particularly one that is garnished
with freshly made toppings. Cheese
sauce and chives, or guacamole, anyone? A high-calorie tip: the Canadian
house speciality Poutine (fries with
gravy and cheese) is rumoured to capture the hearts of unsuspecting dental
professionals. For purists, the classic
“Pommes Schranke“ (fries with mayonnaise and ketchup) also comes highly
recommended.
Cologne chocolate museum
• When: Daily, 10:00–18:00
• Where: Am Schokoladenmuseum
1a, 50678 Cologne
• Information:
www.schokoladenmuseum.de
Cologne cinema treat
Let’s face it: although we try to
take good care of our teeth, chocolate
is one of those temptations that is
hard to resist. Those who make it to
the famous Cologne chocolate museum will not regret it. Likewise,
the gift shop is a must-see.
After an exhausting day at the
fair, what could be better than low
light, a comfy cinema seat and a
large portion of popcorn? Cinematically, Cologne has a lot to offer, and
visitors to the city can have their fill
of film on any night of the week. For
art house lovers, the city is a dream.
Keep an eye out for Filmforum NRW
at Museum Ludwig, Filmpalette, Odeon
and Off Broadway.
Frittenwerk
• When: Monday–Thursday,
11:30–22:00
40th International Dental Show 2023 • 14. März 14 March
• When: Daily, please enquire in advance for details.
• Information: www.kino.de/
kinoprogramm/stadt/koeln
[79] =>
untitled
service
79
Was man zur IDS wissen muss Useful information
Veranstalter
Koelnmesse und Gesellschaft zur
Förderung der Dental-Industrie (GFDI),
Wirtschaftsunternehmen des Verbandes der Deutschen Dental-Industrie
(VDDI)
Veranstaltungsort
Koelnmesse, Messeplatz 1,
50679 Köln, Deutschland, bei
persönlicher Teilnahme
Die digitale Plattform
IDSconnect für die virtuelle
Teilnahme
Öffnungszeiten
14.–18. März 2023
Täglich von 9:00–18:00 Uhr
für Besucher
Täglich von 8:00–19:00 Uhr
für Aussteller
Eintrittspreise
Tageskarte: 15,00 €
Tageskarte für Schüler und
Studenten: 7,50 €
IDSconnect: Kostenlos mit
Registrierung
IDSconnect
Parallel zur physischen Ausstellung bietet die digitale Plattform IDSconnect Informationen über Produkte
und Systemlösungen und ermöglicht
das Streaming von Webinaren, Pressekonferenzen, Veranstaltungen und persönlichen Gesprächen zwischen Unternehmensvertretern und Kunden.
Hygieneprotokolle
Die COVID-19-Beschränkungen für
Messen und Veranstaltungen in Nordrhein-Westfalen wurden vollständig
aufgehoben und Besucherinnen und
Besucher müssen auf dem Messegelände und in den Hallen keinen
Mund-Nasen-Schutz tragen. Die IDSOrganisatoren fördern dennoch die
grundlegenden Hygieneprotokolle wie
regelmäßiges Händewaschen, Niesen in die Armbeuge, Vermeidung
von Körperkontakt und die Nutzung
der bereitgestellten Händedesinfektionsmittel.
Sanitätsstation, Halle 7:
+49 221 821-3517
Sanitätsstation, Halle 11.1:
+49 221 821-2608
Informationszentrale der
Koelnmesse: +49 180 6773577
Messewache Nord:
+49 221 821-2551/-2552
Messewache Ost:
+49 221 821-2549/-2550
Sieg und Rhein-Ruhr kostenlos nutzen. Das Gelände der Koelnmesse ist
gut an das städtische Verkehrsnetz
angebunden. Die S-Bahn-Linien 6, 11,
12 und 19 fahren vom Bahnhof Köln
Messe/Deutz (gegenüber dem Eingang
Süd) ab und erreichen den Kölner
Hauptbahnhof in wenigen Minuten.
Die U-Bahn-Linien 1 und 9 halten an
der Haltestelle Bahnhof Deutz (3 Minuten Fußweg vom Südeingang), die
Linien 3 und 4 an der Haltestelle
Koelnmesse (Osteingang). Taxistände
gibt es an allen vier Haupteingängen.
Bei schönem Wetter bietet die Hohenzollernbrücke Fußgängern eine Alternative unter freiem Himmel, um in
die City zu gelangen.
Koelnmesse and the Society for
the Advancement of the Dental Industry (GFDI), the commercial enterprise
of the Association of the German Dental Industry (VDDI)
Barrierefreie Messe
Venue
Die Messeeingänge Nord, Ost und
West verfügen im Erdgeschoss über
Kassen und Garderoben sowie Aufzüge zu den Messehallen. Der Eingang
Süd ist über einen Außenaufzug über
Tor F zu erreichen. Besucherinnen und
Besucher mit Behinderungen oder
eingeschränkter Mobilität können im
Sanitätszentrum Nord (Halle 7) und
im Sanitätszentrum Ost (Halle 11.1)
gegen Pfand manuelle oder elektrische Rollstühle ausleihen. Behindertentoiletten befinden sich an allen
Eingängen und in den Hallen.
Koelnmesse, Messeplatz 1,
50679 Cologne, Germany,
for in-person attendance
The IDSconnect digital platform
for virtual participation
Internet
Über das WLAN-Netz #hotspot.
koelnmesse ist nach Anmeldung auf
der Portalseite kostenloses WLAN verfügbar.
Geld
In Deutschland gilt der Euro als gesetzliches Zahlungsmittel. Die Wechselkurse lagen am 20. Februar bei 0,94 €
für 1 US-Dollar und 1,13 € für 1 £.
Kontaktloses Bezahlen wird am gesamten Veranstaltungsort akzeptiert.
Organisers
Exhibition opening hours
14–18 March 2023
Daily from 9:00–18:00 for
visitors
Daily from 8:00–19:00 for
exhibitors
Admission price
Day ticket: €15.00
Day ticket for students: €7.50
IDSconnect: Free with
registration
In tandem with the physical exhibition, the IDSconnect digital platform
will offer information on products and
system solutions and will enable the
streaming of webinars, press conferences, events and onte-to-one conversations between company representatives and clients.
Hygiene protocols
Muslimische Gebetsräume befinden sich im Congress-Centrum Ost
(3. Obergeschoss, Raum 6) und in
Halle 8 (Raum 8.2.05).
COVID-19 restrictions for trade
fairs and events in North Rhine-Westphalia have been lifted completely and
visitors are not required to wear face
masks on the fairgrounds or in the
halls. IDS organisers nonetheless encourage the basic hygiene protocols of
regular hand washing, sneezing into
one’s elbow, avoiding physical contact
Wichtige Telefonnummern
Personen in Besitz eines IDS 2023Tickets können die öffentlichen Verkehrsmittel im Verkehrsgebiet Rhein-
Polizei: 110
Feuerwehr und Rettungsdienst:
112
change for a refundable deposit. Disabled toilet facilities are located at all
entrances and throughout the halls.
Getting to and from the show
IDS 2023 ticket holders can use
public transport within both the
Rhein-Sieg and the Rhein-Ruhr transport areas free of charge. The Koelnmesse grounds are well connected to
the city’s transport network. Suburban
(S-Bahn) Lines 6, 11, 12 and 19 depart
from the Köln Messe/Deutz train station (opposite the south entrance) and
reach Cologne main station (Köln Hauptbahnhof) in just a few minutes. Underground Lines 1 and 9 stop at the Bahnhof Deutz station (3 minutes’ walk
from the south entrance), and 3 and 4
stop at the Koelnmesse station (east
entrance). Taxi ranks can be found at
all four main entrances and those
wishing to walk back to the central
city can use the Hohenzollern Bridge.
Barrier-free trade fair
The North, East and West entrances
to the trade fair have box offices and
cloakrooms on the ground floor and
lifts to the exhibition halls. Entrance
South can be reached via an outside
lift via Gate F. Visitors with disabilities or restricted mobility can borrow
manual or electric wheelchairs from
the Medical Centre North (Hall 7) and
Medical Centre East (Hall 11.1) in ex-
Internet
Wi-Fi is available free of charge via
the WLAN network #hotspot.koelnmesse
after registering on the portal site.
Money
Germany uses the euro as legal
tender and the exchange rates as at
20 February were €0.93 to US$1 and
€1.12 to £1.
Contactless payment will be accepted throughout the venue.
Places of worship
Muslim prayer rooms are located
in Congress Centre East (third floor,
Room 6) and in Hall 8 (Room 8.2.05).
Important numbers
Police: 110
Fire and ambulance: 112
Medical centre, Hall 7:
+49 221 821-3517
medical centre, Hall 11.1:
+49 221 821-2608
IDS visitor hotline:
+49 180 6773577
Security Office North:
+49 221 821-2551/-2552
Security Office East:
+49 221 821-2549/-2550
About the publisher
IDSconnect
Andachtsräume
An- und Abreise zur Messe
and using the provided hand disinfection facilities.
Editorial/Administrative Office
ARGE IDS today GBR
Dental Tribune International GmbH
OEMUS MEDIA AG
Holbeinstraße 29
04229 Leipzig
Germany
Phone
+49 341 48474-302
Fax
+49 341 48474-173
Websites
www.zwp-online.info
www.dental-tribune.com
Publisher
Torsten Oemus
Representative,
Dental Tribune International GmbH
Torsten Oemus
Representatives, OEMUS MEDIA AG
Ingolf Döbbecke, Lutz Hiller
Chief Content Officer
Claudia Duschek (V.i.S.d.P.)
Editors
Franziska Beier, Jeremy Booth, John Cisnik, Anisha Hall
Hoppe, Christin Hiller, Kerstin Oesterreich, Iveta Ramonaite
Production Executive
Gernot Meyer
Production
Lisa Greulich, Fanny Haller, Aniko Holzer, Alexander Jahn,
Frank Jahr, Pia Krah, Stephan Krause, Timon Leidenheimer,
Josephine Ritter, Franziska Schmid, Sarah Schröter, Nora
Sommer-Zernechel
today appears ahead of the 40th International Dental Show in
Cologne on 14 March 2023. The newspaper and all articles
and illustrations therein are protected by copyright. Any utilisation without prior consent from the editor or publisher
is inadmissible and liable to prosecution. No responsibility
shall be assumed for information published about associations, companies and commercial markets. General terms
and conditions apply; legal venue is Leipzig, Germany.
40th International Dental Show 2023 • 14. März 14 March
[80] =>
untitled
The New Definition of Implant Success
Prospective long-term study over 9 years
Brunello G, Rauch N, Becker K, Hakimi AR, Schwarz F, Becker J. Two-piece zirconia implants in the
posterior mandible and maxilla: A cohort study with a follow-up period of 9 years. Clin Oral Implants
Res. 2022 Dec;33(12):1233-1244. doi: 10.1111/clr.14005. Epub 2022 Oct 31. PMID: 36184914.
• Healthy soft tissues
• Stable bone levels
• No peri-implantitis
er
D i s c ov
S!
D
I
t
a
™
Pate nt
.1
0
1
l
l
a
H
1
6
0
D
B o ot h
The New Standard
Long-term oral health: Patent™ has redefined
implant success in the groundbreaking
9-year study. Learn more at
www.mypatent.com/scientific-studies
Zircon Medical Management AG, Switzerland
)
[page_count] => 80
[pdf_ping_data] => Array
(
[page_count] => 80
[format] => PDF
[width] => 794
[height] => 1134
[colorspace] => COLORSPACE_UNDEFINED
)
[linked_companies] => Array
(
[ids] => Array
(
)
)
[cover_url] =>
[cover_three] =>
[cover] => ![today at IDS Cologne 14 March 2023]()
[toc] => Array
(
[0] => Array
(
[title] => News
[page] => 1
)
[1] => Array
(
[title] => Mit edelweiss dentistry die optimale Integration von Funktion und Ästhetik realisieren - Realising optimal integration of function and aesthetics with edelweiss dentistry
[page] => 8
)
[2] => Array
(
[title] => Fachhändler setzt auf Weitsicht und Regionalität - Retailer focuses on further development and regional markets
[page] => 10
)
[3] => Array
(
[title] => Impressionen des Vor-IDS-Tages - Impressions from the pre-IDS day
[page] => 14
)
[4] => Array
(
[title] => Industry
[page] => 18
)
[5] => Array
(
[title] => Was ist sonst noch los in Köln? - What’s on in Cologne?
[page] => 78
)
[6] => Array
(
[title] => Was man zur IDS wissen muss - Useful information
[page] => 79
)
)
[toc_html] =>
[toc_titles] => News
/ Mit edelweiss dentistry die optimale Integration von Funktion und Ästhetik realisieren - Realising optimal integration of function and aesthetics with edelweiss dentistry
/ Fachhändler setzt auf Weitsicht und Regionalität - Retailer focuses on further development and regional markets
/ Impressionen des Vor-IDS-Tages - Impressions from the pre-IDS day
/ Industry
/ Was ist sonst noch los in Köln? - What’s on in Cologne?
/ Was man zur IDS wissen muss - Useful information
[cached] => true
)
